BLASTX nr result
ID: Astragalus24_contig00018209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018209 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN15443.1| hypothetical protein glysoja_036311, partial [Gly... 52 4e-06 >gb|KHN15443.1| hypothetical protein glysoja_036311, partial [Glycine soja] Length = 85 Score = 51.6 bits (122), Expect = 4e-06 Identities = 18/36 (50%), Positives = 29/36 (80%) Frame = -2 Query: 353 LRKQLLKCSQGTLSVSSYYTKFRPLWEEFNDYRLIH 246 L+K++L C+QG+ S+SSYY KF+ +WE+ +YR +H Sbjct: 46 LKKEMLNCTQGSSSISSYYNKFKAMWEQLGEYRPVH 81