BLASTX nr result
ID: Astragalus24_contig00018134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018134 (785 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38344.1| Glutathione S-transferase F9 [Glycine soja] 63 7e-09 ref|XP_013454367.1| glutathione S-transferase [Medicago truncatu... 64 9e-09 gb|ACU19757.1| unknown [Glycine max] 58 2e-07 ref|XP_004488878.2| PREDICTED: glutathione S-transferase F10-lik... 58 1e-06 ref|NP_001236500.1| glutathione S-transferase GST 24 [Glycine ma... 58 2e-06 ref|XP_004491311.1| PREDICTED: glutathione S-transferase F9-like... 58 2e-06 gb|ACU13420.1| unknown [Glycine max] 58 2e-06 ref|XP_004491312.1| PREDICTED: glutathione S-transferase F9-like... 58 2e-06 gb|KDO40902.1| hypothetical protein CISIN_1g027956mg [Citrus sin... 57 2e-06 ref|XP_019459539.1| PREDICTED: glutathione S-transferase F9-like... 57 4e-06 gb|AFK35789.1| unknown [Medicago truncatula] 57 4e-06 ref|XP_006484982.1| PREDICTED: glutathione S-transferase F9 [Cit... 57 4e-06 ref|XP_003617377.1| glutathione S-transferase, amino-terminal do... 57 4e-06 ref|XP_003617376.1| glutathione S-transferase [Medicago truncatu... 57 4e-06 ref|XP_022846261.1| uncharacterized protein LOC111369003 [Olea e... 58 5e-06 ref|XP_006437115.2| glutathione S-transferase F10 isoform X1 [Ci... 57 6e-06 gb|AFK45563.1| unknown [Lotus japonicus] 57 6e-06 ref|XP_020206649.1| glutathione S-transferase F9-like [Cajanus c... 56 8e-06 >gb|KHN38344.1| Glutathione S-transferase F9 [Glycine soja] Length = 119 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 96 CICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 C AESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 55 CFSAESRAIMRYYAEKYRSQGVELLGKTIEER 86 >ref|XP_013454367.1| glutathione S-transferase [Medicago truncatula] gb|KEH28398.1| glutathione S-transferase [Medicago truncatula] Length = 159 Score = 63.5 bits (153), Expect = 9e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 93 ICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 ICAESRAIMRYYAEKYRSQGVELLGKTIEE+ Sbjct: 5 ICAESRAIMRYYAEKYRSQGVELLGKTIEEK 35 >gb|ACU19757.1| unknown [Glycine max] Length = 98 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEER 92 >ref|XP_004488878.2| PREDICTED: glutathione S-transferase F10-like [Cicer arietinum] Length = 175 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 52 ESRAIMRYYAEKYRSQGVELLGKTIEER 79 >ref|NP_001236500.1| glutathione S-transferase GST 24 [Glycine max] gb|AAG34814.1|AF243379_1 glutathione S-transferase GST 24 [Glycine max] gb|KHN11988.1| Glutathione S-transferase F9 [Glycine soja] gb|AJE59622.1| phi class glutathione S-transferase [Glycine max] gb|KRH14517.1| hypothetical protein GLYMA_14G031000 [Glycine max] Length = 215 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEER 92 >ref|XP_004491311.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum] Length = 215 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEER 92 >gb|ACU13420.1| unknown [Glycine max] Length = 215 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEER 92 >ref|XP_004491312.1| PREDICTED: glutathione S-transferase F9-like [Cicer arietinum] Length = 219 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEER 92 >gb|KDO40902.1| hypothetical protein CISIN_1g027956mg [Citrus sinensis] Length = 170 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 93 ICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 I ESRAIMRYYAEKYRSQG ELLGKTIEER Sbjct: 16 ILYESRAIMRYYAEKYRSQGTELLGKTIEER 46 >ref|XP_019459539.1| PREDICTED: glutathione S-transferase F9-like [Lupinus angustifolius] gb|OIW02836.1| hypothetical protein TanjilG_29612 [Lupinus angustifolius] Length = 214 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYY+EKYRSQGVELLGKTIEER Sbjct: 65 ESRAIMRYYSEKYRSQGVELLGKTIEER 92 >gb|AFK35789.1| unknown [Medicago truncatula] Length = 216 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEE+ Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEEK 92 >ref|XP_006484982.1| PREDICTED: glutathione S-transferase F9 [Citrus sinensis] gb|KDO40901.1| hypothetical protein CISIN_1g027956mg [Citrus sinensis] Length = 216 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 93 ICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 I ESRAIMRYYAEKYRSQG ELLGKTIEER Sbjct: 62 ILYESRAIMRYYAEKYRSQGTELLGKTIEER 92 >ref|XP_003617377.1| glutathione S-transferase, amino-terminal domain protein [Medicago truncatula] gb|AET00336.1| glutathione S-transferase, amino-terminal domain protein [Medicago truncatula] Length = 216 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEE+ Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEEK 92 >ref|XP_003617376.1| glutathione S-transferase [Medicago truncatula] gb|AET00335.1| glutathione S-transferase [Medicago truncatula] Length = 216 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLGKTIEE+ Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGKTIEEK 92 >ref|XP_022846261.1| uncharacterized protein LOC111369003 [Olea europaea var. sylvestris] Length = 428 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 96 CICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 C CA+SRA+MRYYAEKY S+G ELLGKT+EER Sbjct: 97 CTCAQSRALMRYYAEKYMSKGTELLGKTLEER 128 >ref|XP_006437115.2| glutathione S-transferase F10 isoform X1 [Citrus clementina] Length = 239 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 93 ICAESRAIMRYYAEKYRSQGVELLGKTIEER 1 I ESRAIMRYYAEKYRSQG ELLGKTIEER Sbjct: 85 ILYESRAIMRYYAEKYRSQGTELLGKTIEER 115 >gb|AFK45563.1| unknown [Lotus japonicus] Length = 215 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQG++LLGKTIEER Sbjct: 65 ESRAIMRYYAEKYRSQGIDLLGKTIEER 92 >ref|XP_020206649.1| glutathione S-transferase F9-like [Cajanus cajan] gb|KYP34960.1| Glutathione S-transferase ERD13 [Cajanus cajan] Length = 215 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 84 ESRAIMRYYAEKYRSQGVELLGKTIEER 1 ESRAIMRYYAEKYRSQGVELLG TIEER Sbjct: 65 ESRAIMRYYAEKYRSQGVELLGNTIEER 92