BLASTX nr result
ID: Astragalus24_contig00018110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00018110 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP13077.1| auxin responsive protein IAA-Re [Gossypium barbad... 68 1e-11 ref|XP_014512035.1| auxin-induced protein 22B [Vigna radiata var... 70 2e-11 ref|XP_017413350.1| PREDICTED: auxin-induced protein 22B-like [V... 70 2e-11 ref|XP_019428920.1| PREDICTED: auxin-induced protein 22B-like [L... 70 2e-11 ref|XP_007034953.2| PREDICTED: auxin-responsive protein IAA4 [Th... 70 2e-11 ref|XP_007143879.1| hypothetical protein PHAVU_007G109700g [Phas... 70 2e-11 pdb|2M1M|A Chain A, Solution Structure Of The Psiaa4 Oligomeriza... 67 3e-11 ref|XP_021290455.1| auxin-induced protein 22B-like [Herrania umb... 69 3e-11 ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [C... 69 4e-11 gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Gl... 67 4e-11 ref|XP_003535418.1| PREDICTED: auxin-induced protein 22B [Glycin... 67 5e-11 ref|XP_013466973.1| auxin response factor [Medicago truncatula] ... 69 6e-11 gb|KYP46364.1| Auxin-induced protein 22B [Cajanus cajan] 69 6e-11 ref|XP_004498012.1| PREDICTED: auxin-induced protein IAA4-like [... 69 7e-11 gb|AFK43880.1| unknown [Lotus japonicus] 68 7e-11 ref|XP_003520159.1| PREDICTED: auxin-induced protein 22B-like [G... 68 9e-11 ref|XP_022761106.1| auxin-induced protein 22B-like [Durio zibeth... 68 1e-10 ref|XP_016729085.1| PREDICTED: auxin-responsive protein IAA4-lik... 68 1e-10 gb|AAQ74955.1| Gbiaa-Re [Gossypium barbadense] 68 1e-10 gb|OVA05344.1| AUX/IAA protein [Macleaya cordata] 68 1e-10 >gb|AAP13077.1| auxin responsive protein IAA-Re [Gossypium barbadense] Length = 91 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 61 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 91 >ref|XP_014512035.1| auxin-induced protein 22B [Vigna radiata var. radiata] Length = 182 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 152 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 182 >ref|XP_017413350.1| PREDICTED: auxin-induced protein 22B-like [Vigna angularis] gb|KOM35582.1| hypothetical protein LR48_Vigan02g173200 [Vigna angularis] Length = 190 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 160 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 190 >ref|XP_019428920.1| PREDICTED: auxin-induced protein 22B-like [Lupinus angustifolius] gb|OIV90721.1| hypothetical protein TanjilG_15107 [Lupinus angustifolius] Length = 192 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 162 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 192 >ref|XP_007034953.2| PREDICTED: auxin-responsive protein IAA4 [Theobroma cacao] Length = 192 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 162 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 192 >ref|XP_007143879.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] gb|ESW15873.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris] Length = 193 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV Sbjct: 163 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 193 >pdb|2M1M|A Chain A, Solution Structure Of The Psiaa4 Oligomerization Domain Reveals Interaction Modes For Transcription Factors In Early Auxin Response Length = 107 Score = 67.4 bits (163), Expect = 3e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKG+EA+GLGCGV Sbjct: 74 VGDVPWDMFVTSCKRLRIMKGTEAKGLGCGV 104 >ref|XP_021290455.1| auxin-induced protein 22B-like [Herrania umbratica] Length = 192 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMF+TSCKRLRIMKGSEARGLGCGV Sbjct: 162 VGDVPWDMFITSCKRLRIMKGSEARGLGCGV 192 >ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [Cicer arietinum] Length = 183 Score = 68.9 bits (167), Expect = 4e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARG+GCGV Sbjct: 153 VGDVPWDMFVTSCKRLRIMKGSEARGIGCGV 183 >gb|KRH34375.1| hypothetical protein GLYMA_10G180000, partial [Glycine max] Length = 122 Score = 67.4 bits (163), Expect = 4e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 92 VGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 122 >ref|XP_003535418.1| PREDICTED: auxin-induced protein 22B [Glycine max] Length = 125 Score = 67.4 bits (163), Expect = 5e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKGSEARGLGC V Sbjct: 95 VGDVPWDMFVTSCKRLRIMKGSEARGLGCAV 125 >ref|XP_013466973.1| auxin response factor [Medicago truncatula] gb|AFK34460.1| unknown [Medicago truncatula] gb|KEH41009.1| auxin response factor [Medicago truncatula] Length = 186 Score = 68.6 bits (166), Expect = 6e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 156 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 186 >gb|KYP46364.1| Auxin-induced protein 22B [Cajanus cajan] Length = 191 Score = 68.6 bits (166), Expect = 6e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMF+TSCKRLRIMKGSEARGLGCGV Sbjct: 161 VGDVPWDMFMTSCKRLRIMKGSEARGLGCGV 191 >ref|XP_004498012.1| PREDICTED: auxin-induced protein IAA4-like [Cicer arietinum] Length = 195 Score = 68.6 bits (166), Expect = 7e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMFVTSCKRLRIMKG+EARGLGCGV Sbjct: 165 VGDVPWDMFVTSCKRLRIMKGTEARGLGCGV 195 >gb|AFK43880.1| unknown [Lotus japonicus] Length = 177 Score = 68.2 bits (165), Expect = 7e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPW+MFVTSCKRLRIMKGSEARGLGCGV Sbjct: 147 VGDVPWEMFVTSCKRLRIMKGSEARGLGCGV 177 >ref|XP_003520159.1| PREDICTED: auxin-induced protein 22B-like [Glycine max] gb|KHN15404.1| Auxin-induced protein 22B [Glycine soja] gb|KRH69048.1| hypothetical protein GLYMA_02G000500 [Glycine max] Length = 192 Score = 68.2 bits (165), Expect = 9e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMF+TSCKRLR+MKGSEARGLGCGV Sbjct: 162 VGDVPWDMFMTSCKRLRVMKGSEARGLGCGV 192 >ref|XP_022761106.1| auxin-induced protein 22B-like [Durio zibethinus] Length = 188 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 158 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 188 >ref|XP_016729085.1| PREDICTED: auxin-responsive protein IAA4-like [Gossypium hirsutum] ref|XP_017632291.1| PREDICTED: auxin-responsive protein IAA4-like [Gossypium arboreum] Length = 190 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 160 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 190 >gb|AAQ74955.1| Gbiaa-Re [Gossypium barbadense] Length = 190 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPW+MF+TSCKRLRIMKGSEARGLGCGV Sbjct: 160 VGDVPWEMFITSCKRLRIMKGSEARGLGCGV 190 >gb|OVA05344.1| AUX/IAA protein [Macleaya cordata] Length = 199 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 573 VGDVPWDMFVTSCKRLRIMKGSEARGLGCGV 481 VGDVPWDMF++SCKRLRIMKGSEARGLGCGV Sbjct: 169 VGDVPWDMFISSCKRLRIMKGSEARGLGCGV 199