BLASTX nr result
ID: Astragalus24_contig00017890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00017890 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU42970.1| hypothetical protein TSUD_188430 [Trifolium subt... 42 7e-06 gb|KRH35933.1| hypothetical protein GLYMA_10G272900 [Glycine max] 51 8e-06 >dbj|GAU42970.1| hypothetical protein TSUD_188430 [Trifolium subterraneum] Length = 767 Score = 42.0 bits (97), Expect(2) = 7e-06 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -1 Query: 319 VFGDLCKGTKARKVKHLVWLSSCWCIWLGRNGCV*EG 209 +FG L K + KV+HL+WL++ W IW RN V G Sbjct: 684 IFGSLLKTKRFEKVRHLIWLATTWSIWKLRNNVVFNG 720 Score = 35.4 bits (80), Expect(2) = 7e-06 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 425 HLFLNCSVVRNVWAEINRWLDMQVPISHDIVLHFICFWRLMQ 300 HLF +CSV++ VW E+ +W D HF F L++ Sbjct: 649 HLFFHCSVLKRVWEEVFKWFGKSYQAEADGWNHFNIFGSLLK 690 >gb|KRH35933.1| hypothetical protein GLYMA_10G272900 [Glycine max] Length = 79 Score = 51.2 bits (121), Expect(2) = 8e-06 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = -1 Query: 316 FGDLCKGTKARKVKHLVWLSSCWCIWLGRNGCV 218 FG L G K+R+VKH++W ++CWC+WL RN + Sbjct: 45 FGGLLPGRKSRRVKHILWHATCWCVWLSRNAII 77 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -3 Query: 431 LRHLFLNCSVVRNVWAEINRWLDMQV 354 + HLF C V ++W ++ W+ + + Sbjct: 7 VHHLFYACQVTASIWRQVIAWVGVNL 32