BLASTX nr result
ID: Astragalus24_contig00017868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00017868 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498046.1| PREDICTED: glycerol-3-phosphate dehydrogenas... 56 2e-06 >ref|XP_004498046.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(+)] GPDHC1, cytosolic isoform X1 [Cicer arietinum] Length = 459 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 331 MGEVSNTYSNGSIQNCNNGLEEKLDELRRLI 423 MG +SN SNGS+QNCNNGLEEKLDELRRL+ Sbjct: 1 MGVISNADSNGSVQNCNNGLEEKLDELRRLL 31