BLASTX nr result
ID: Astragalus24_contig00017714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00017714 (332 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU18533.1| unknown, partial [Glycine max] 57 2e-07 >gb|ACU18533.1| unknown, partial [Glycine max] Length = 174 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +2 Query: 23 EDVENGTKVFLVALKMLVL*SLTPMVPLIGKMKQLL*WTLQRCFSHMNL 169 EDVENGT+VFLVAL++L L PMVPLI ++KQ+L W Q+ FS+ +L Sbjct: 75 EDVENGTRVFLVALEILGFGILIPMVPLIDRVKQMLYWKGQKGFSNTDL 123