BLASTX nr result
ID: Astragalus24_contig00017529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00017529 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU33882.1| hypothetical protein TSUD_66690 [Trifolium subte... 55 3e-06 >dbj|GAU33882.1| hypothetical protein TSUD_66690 [Trifolium subterraneum] Length = 308 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 5/40 (12%) Frame = +1 Query: 88 RVLCWA-----VGIKSGGSVIAPCVWLQSGLVSFVVNEVL 192 ++ CW +GIKSGGSVIAPCV +QSGLVS VVNEVL Sbjct: 237 QIKCWGGSVPLIGIKSGGSVIAPCVQIQSGLVSIVVNEVL 276