BLASTX nr result
ID: Astragalus24_contig00017411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00017411 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW10297.1| hypothetical protein TanjilG_28048 [Lupinus angus... 59 6e-09 gb|OIV94048.1| hypothetical protein TanjilG_14295 [Lupinus angus... 58 1e-08 gb|PPR91538.1| hypothetical protein GOBAR_AA29138 [Gossypium bar... 63 1e-08 gb|OIW04749.1| hypothetical protein TanjilG_08632 [Lupinus angus... 58 1e-08 gb|KYP45394.1| Cullin-3 [Cajanus cajan] 59 1e-08 gb|EFH63556.1| hypothetical protein ARALYDRAFT_894845 [Arabidops... 58 5e-08 gb|KOM31428.1| hypothetical protein LR48_Vigan01g098300 [Vigna a... 59 2e-07 ref|XP_017405359.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-li... 59 2e-07 ref|XP_020236761.1| cullin-3A-like isoform X1 [Cajanus cajan] >g... 59 2e-07 ref|XP_019445949.1| PREDICTED: cullin-3A-like [Lupinus angustifo... 59 2e-07 ref|XP_019445650.1| PREDICTED: cullin-3A-like isoform X1 [Lupinu... 59 2e-07 dbj|BAT74528.1| hypothetical protein VIGAN_01221500 [Vigna angul... 59 2e-07 ref|XP_014509391.1| cullin-3A isoform X1 [Vigna radiata var. rad... 59 2e-07 ref|XP_007153599.1| hypothetical protein PHAVU_003G049300g [Phas... 59 2e-07 ref|XP_004511215.1| PREDICTED: cullin-3A-like [Cicer arietinum] 59 2e-07 ref|XP_003532060.1| PREDICTED: cullin-3A-like [Glycine max] >gi|... 59 2e-07 ref|XP_019455997.1| PREDICTED: cullin-3A-like isoform X1 [Lupinu... 58 6e-07 ref|XP_019421511.1| PREDICTED: cullin-3A-like [Lupinus angustifo... 58 6e-07 ref|XP_003551967.1| PREDICTED: cullin-3A-like isoform X1 [Glycin... 58 6e-07 gb|OMO93160.1| hypothetical protein CCACVL1_06615 [Corchorus cap... 58 7e-07 >gb|OIW10297.1| hypothetical protein TanjilG_28048 [Lupinus angustifolius] Length = 72 Score = 59.3 bits (142), Expect = 6e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >gb|OIV94048.1| hypothetical protein TanjilG_14295 [Lupinus angustifolius] Length = 54 Score = 58.2 bits (139), Expect = 1e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN++KRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQRKRNFQIEAFKHRVVMDPKYADKTW 29 >gb|PPR91538.1| hypothetical protein GOBAR_AA29138 [Gossypium barbadense] Length = 1144 Score = 63.2 bits (152), Expect = 1e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 345 GWENMSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 GW+ MSN+KKRNFQIEAFKHRVV+ PKY++KTW Sbjct: 36 GWKEMSNQKKRNFQIEAFKHRVVVDPKYAEKTW 68 >gb|OIW04749.1| hypothetical protein TanjilG_08632 [Lupinus angustifolius] Length = 61 Score = 58.2 bits (139), Expect = 1e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN++KRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQRKRNFQIEAFKHRVVMDPKYADKTW 29 >gb|KYP45394.1| Cullin-3 [Cajanus cajan] Length = 108 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >gb|EFH63556.1| hypothetical protein ARALYDRAFT_894845 [Arabidopsis lyrata subsp. lyrata] Length = 103 Score = 57.8 bits (138), Expect = 5e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVV+ PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVVDPKYADKTW 29 >gb|KOM31428.1| hypothetical protein LR48_Vigan01g098300 [Vigna angularis] Length = 669 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_017405359.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-like [Vigna angularis] Length = 700 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_020236761.1| cullin-3A-like isoform X1 [Cajanus cajan] ref|XP_020236762.1| cullin-3A-like isoform X2 [Cajanus cajan] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_019445949.1| PREDICTED: cullin-3A-like [Lupinus angustifolius] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_019445650.1| PREDICTED: cullin-3A-like isoform X1 [Lupinus angustifolius] ref|XP_019445658.1| PREDICTED: cullin-3A-like isoform X2 [Lupinus angustifolius] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >dbj|BAT74528.1| hypothetical protein VIGAN_01221500 [Vigna angularis var. angularis] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_014509391.1| cullin-3A isoform X1 [Vigna radiata var. radiata] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_007153599.1| hypothetical protein PHAVU_003G049300g [Phaseolus vulgaris] gb|ESW25593.1| hypothetical protein PHAVU_003G049300g [Phaseolus vulgaris] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_004511215.1| PREDICTED: cullin-3A-like [Cicer arietinum] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_003532060.1| PREDICTED: cullin-3A-like [Glycine max] gb|KHN06849.1| Cullin-3A [Glycine soja] gb|KRH45896.1| hypothetical protein GLYMA_08G300100 [Glycine max] gb|KRH45897.1| hypothetical protein GLYMA_08G300100 [Glycine max] Length = 732 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_019455997.1| PREDICTED: cullin-3A-like isoform X1 [Lupinus angustifolius] ref|XP_019455998.1| PREDICTED: cullin-3A-like isoform X2 [Lupinus angustifolius] Length = 732 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN++KRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQRKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_019421511.1| PREDICTED: cullin-3A-like [Lupinus angustifolius] Length = 732 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN++KRNFQIEAFKHRVVM PKY+DKTW Sbjct: 1 MSNQRKRNFQIEAFKHRVVMDPKYADKTW 29 >ref|XP_003551967.1| PREDICTED: cullin-3A-like isoform X1 [Glycine max] gb|KRG99095.1| hypothetical protein GLYMA_18G120300 [Glycine max] Length = 732 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRV+M PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVLMDPKYADKTW 29 >gb|OMO93160.1| hypothetical protein CCACVL1_06615 [Corchorus capsularis] Length = 403 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 357 MSNRKKRNFQIEAFKHRVVMVPKYSDKTW 443 MSN+KKRNFQIEAFKHRVV+ PKY+DKTW Sbjct: 1 MSNQKKRNFQIEAFKHRVVVDPKYADKTW 29