BLASTX nr result
ID: Astragalus24_contig00016968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016968 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX98607.1| pentatricopeptide repeat-containing protein at1g0... 74 6e-12 ref|XP_019415827.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-10 ref|XP_004488287.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_013463792.1| pentatricopeptide (PPR) repeat protein [Medi... 67 2e-09 ref|XP_016194825.1| pentatricopeptide repeat-containing protein ... 65 5e-09 ref|XP_015962901.1| pentatricopeptide repeat-containing protein ... 65 5e-09 gb|KHN18673.1| Pentatricopeptide repeat-containing protein, part... 62 8e-08 ref|XP_014617509.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 gb|KRH37749.1| hypothetical protein GLYMA_09G086600 [Glycine max] 62 9e-08 ref|XP_007138513.1| hypothetical protein PHAVU_009G215500g, part... 59 9e-07 gb|KYP63712.1| Pentatricopeptide repeat-containing protein At1g0... 58 2e-06 ref|XP_020218505.1| pentatricopeptide repeat-containing protein ... 58 2e-06 ref|XP_017422967.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_014498621.1| pentatricopeptide repeat-containing protein ... 57 4e-06 >gb|PNX98607.1| pentatricopeptide repeat-containing protein at1g03540-like protein [Trifolium pratense] Length = 620 Score = 73.6 bits (179), Expect = 6e-12 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVNVFGESSDSSMREAV 150 W+DA+EIRKLM DRGVKKL KSWI SENR GS VNV E S SSM+EAV Sbjct: 571 WDDAVEIRKLMVDRGVKKLTAKSWIDSENRNGSHVNVCTEKSISSMQEAV 620 >ref|XP_019415827.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Lupinus angustifolius] ref|XP_019415828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Lupinus angustifolius] gb|OIV98307.1| hypothetical protein TanjilG_16634 [Lupinus angustifolius] Length = 626 Score = 69.3 bits (168), Expect = 2e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVNV 111 WNDALEIRKLMEDRGVKK+PGKSW+ +EN+KGSR+++ Sbjct: 583 WNDALEIRKLMEDRGVKKIPGKSWVDNENQKGSRLDL 619 >ref|XP_004488287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] ref|XP_004488288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] ref|XP_004488289.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Cicer arietinum] Length = 612 Score = 67.0 bits (162), Expect = 1e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVNV 111 W+DA+EIRKLMEDRGVKKLPGKSWI EN+KGS V V Sbjct: 574 WDDAVEIRKLMEDRGVKKLPGKSWIDGENQKGSHVEV 610 >ref|XP_013463792.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|KEH37827.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 625 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVN 108 W+DALEIRKLMEDRGVKK+ GKSWI S+NRKGS +N Sbjct: 573 WDDALEIRKLMEDRGVKKMAGKSWIDSQNRKGSHIN 608 >ref|XP_016194825.1| pentatricopeptide repeat-containing protein At1g03540 [Arachis ipaensis] Length = 635 Score = 65.1 bits (157), Expect = 5e-09 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 5/51 (9%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS-----RVNVFGESSDSSM 138 WNDAL IRKLMEDRGVKK+PGKSWI SEN+K S +++ G+SS SM Sbjct: 580 WNDALAIRKLMEDRGVKKMPGKSWIESENQKRSHFDLANMSIAGKSSTYSM 630 >ref|XP_015962901.1| pentatricopeptide repeat-containing protein At1g03540 [Arachis duranensis] Length = 637 Score = 65.1 bits (157), Expect = 5e-09 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 5/51 (9%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS-----RVNVFGESSDSSM 138 WNDAL IRKLMEDRGV+K+PGKSWI SE++KGS +++ G+SS SM Sbjct: 582 WNDALAIRKLMEDRGVRKMPGKSWIESEDQKGSHFDLANMSIAGKSSTYSM 632 >gb|KHN18673.1| Pentatricopeptide repeat-containing protein, partial [Glycine soja] Length = 489 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WN+ALEIRKLME+RGVKK+PGKSWI SE +KGS Sbjct: 454 WNEALEIRKLMEERGVKKVPGKSWIESEKQKGS 486 >ref|XP_014617509.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Glycine max] Length = 611 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WN+ALEIRKLME+RGVKK+PGKSWI SE +KGS Sbjct: 576 WNEALEIRKLMEERGVKKVPGKSWIESEKQKGS 608 >gb|KRH37749.1| hypothetical protein GLYMA_09G086600 [Glycine max] Length = 664 Score = 61.6 bits (148), Expect = 9e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WN+ALEIRKLME+RGVKK+PGKSWI SE +KGS Sbjct: 629 WNEALEIRKLMEERGVKKVPGKSWIESEKQKGS 661 >ref|XP_007138513.1| hypothetical protein PHAVU_009G215500g, partial [Phaseolus vulgaris] gb|ESW10507.1| hypothetical protein PHAVU_009G215500g, partial [Phaseolus vulgaris] Length = 570 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WN+ALEIR+LME+RGVKK+PG SWI SE +KGS Sbjct: 522 WNEALEIRRLMEERGVKKMPGTSWIESEKQKGS 554 >gb|KYP63712.1| Pentatricopeptide repeat-containing protein At1g03540 family [Cajanus cajan] Length = 399 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVNVFGESSDSSMREAV 150 WN+ALEIRKLME+RGVKK+PGKSW+ SE ++ SM EAV Sbjct: 350 WNEALEIRKLMEERGVKKMPGKSWVESEKKQKGSPGFDFSIVGKSMGEAV 399 >ref|XP_020218505.1| pentatricopeptide repeat-containing protein At1g03540 [Cajanus cajan] Length = 632 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGSRVNVFGESSDSSMREAV 150 WN+ALEIRKLME+RGVKK+PGKSW+ SE ++ SM EAV Sbjct: 583 WNEALEIRKLMEERGVKKMPGKSWVESEKKQKGSPGFDFSIVGKSMGEAV 632 >ref|XP_017422967.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540 [Vigna angularis] gb|KOM44377.1| hypothetical protein LR48_Vigan05g198200 [Vigna angularis] dbj|BAT91693.1| hypothetical protein VIGAN_07031100 [Vigna angularis var. angularis] Length = 602 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WNDA EIR+LME+RGVKK+PG SW+ SE +KGS Sbjct: 551 WNDAQEIRRLMEERGVKKMPGTSWVESEKQKGS 583 >ref|XP_014498621.1| pentatricopeptide repeat-containing protein At1g03540 [Vigna radiata var. radiata] Length = 599 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 1 WNDALEIRKLMEDRGVKKLPGKSWIGSENRKGS 99 WNDA EIR++ME+RGVKK+PG SW+ SE +KGS Sbjct: 551 WNDAQEIRRIMEERGVKKMPGTSWVESEKQKGS 583