BLASTX nr result
ID: Astragalus24_contig00016912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016912 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY15589.1| pentatricopeptide repeat-containing protein at3g2... 83 7e-16 ref|XP_013466981.1| PPR containing plant-like protein [Medicago ... 82 1e-15 dbj|GAU47920.1| hypothetical protein TSUD_13900 [Trifolium subte... 80 6e-15 ref|XP_012570487.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-14 ref|XP_019464871.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-14 ref|XP_014618342.1| PREDICTED: pentatricopeptide repeat-containi... 78 4e-14 gb|KHN10094.1| Pentatricopeptide repeat-containing protein [Glyc... 77 7e-14 gb|KYP38179.1| Pentatricopeptide repeat-containing protein At3g2... 75 3e-13 ref|XP_017412324.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-13 ref|XP_020204163.1| pentatricopeptide repeat-containing protein ... 75 3e-13 ref|XP_016169922.1| pentatricopeptide repeat-containing protein ... 75 5e-13 ref|XP_014511155.1| pentatricopeptide repeat-containing protein ... 74 9e-13 ref|XP_016183113.1| pentatricopeptide repeat-containing protein ... 72 3e-12 ref|XP_015948661.1| pentatricopeptide repeat-containing protein ... 71 8e-12 ref|XP_007148597.1| hypothetical protein PHAVU_006G222000g [Phas... 70 3e-11 ref|XP_007148598.1| hypothetical protein PHAVU_006G222000g [Phas... 70 3e-11 ref|XP_010051882.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-10 gb|PRQ36223.1| putative tetratricopeptide-like helical domain-co... 63 4e-10 ref|XP_007144179.1| hypothetical protein PHAVU_007G135000g [Phas... 65 1e-09 ref|XP_017434411.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-09 >gb|PNY15589.1| pentatricopeptide repeat-containing protein at3g23020-like protein [Trifolium pratense] Length = 829 Score = 82.8 bits (203), Expect = 7e-16 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 4/66 (6%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE----VME*KW 169 PDDFTFRALG +L NFGV KQ IGRLEVM K+D P GL+AWM+ LSR+L+ + + KW Sbjct: 763 PDDFTFRALGSLLLNFGVSKQNIGRLEVMVKRDTPRGLKAWMVVLSRLLDGNDYIDDWKW 822 Query: 170 LFMDGA 187 L M A Sbjct: 823 LLMGEA 828 >ref|XP_013466981.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH41016.1| PPR containing plant-like protein [Medicago truncatula] Length = 823 Score = 82.0 bits (201), Expect = 1e-15 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 4/66 (6%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE----VME*KW 169 PDDFTFRALGH+L ++GV K+ IG LEVM K++ P GLQAWM+ALS VL E KW Sbjct: 757 PDDFTFRALGHLLLSYGVSKRNIGMLEVMVKRNAPRGLQAWMMALSCVLNGDDYTHEWKW 816 Query: 170 LFMDGA 187 L +DGA Sbjct: 817 LLVDGA 822 >dbj|GAU47920.1| hypothetical protein TSUD_13900 [Trifolium subterraneum] Length = 816 Score = 80.1 bits (196), Expect = 6e-15 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVL 148 PDDFTFRALG +L NFGV KQ+IGRLEVM K+D P G QAWM+ALSR+L Sbjct: 761 PDDFTFRALGQLLLNFGVSKQSIGRLEVMVKRDAPRGFQAWMVALSRLL 809 >ref|XP_012570487.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020-like [Cicer arietinum] Length = 825 Score = 78.6 bits (192), Expect = 2e-14 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRALG +L N GV KQ+IGRLEVM K++ P GLQAWM+A+SR+LE Sbjct: 769 PDDFTFRALGRLLLNHGVSKQSIGRLEVMVKREVPRGLQAWMMAISRMLE 818 >ref|XP_019464871.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Lupinus angustifolius] gb|OIV98764.1| hypothetical protein TanjilG_20510 [Lupinus angustifolius] Length = 839 Score = 78.6 bits (192), Expect = 2e-14 Identities = 42/67 (62%), Positives = 47/67 (70%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEVME*KWLFMD 181 PDDFTF+ALG+VL N GV KQ IGRLEVM KKD G+QAWMLALS VLE E L M+ Sbjct: 770 PDDFTFKALGYVLLNCGVSKQAIGRLEVMVKKDASRGMQAWMLALSCVLEGDEYSKLQMN 829 Query: 182 GALLFWL 202 W+ Sbjct: 830 RCGYSWM 836 >ref|XP_014618342.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020-like [Glycine max] gb|KRH31630.1| hypothetical protein GLYMA_10G001500 [Glycine max] Length = 787 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRAL ++L N GV KQ +GRLEVM K+D PHGLQAWMLALS E Sbjct: 731 PDDFTFRALANILLNCGVSKQAVGRLEVMVKRDAPHGLQAWMLALSCAFE 780 >gb|KHN10094.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 490 Score = 77.0 bits (188), Expect = 7e-14 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALS 139 PDDFTFRAL ++L N GV KQ +GRLEVM K+D PHGLQAWMLALS Sbjct: 445 PDDFTFRALANILLNCGVSKQAVGRLEVMVKRDAPHGLQAWMLALS 490 >gb|KYP38179.1| Pentatricopeptide repeat-containing protein At3g23020 family [Cajanus cajan] Length = 649 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRAL H+L N G Q +GRLEVM K+D P GLQAWMLALS V E Sbjct: 593 PDDFTFRALAHILLNCGASNQAVGRLEVMVKRDAPGGLQAWMLALSSVYE 642 >ref|XP_017412324.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412325.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412326.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412329.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412330.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] ref|XP_017412331.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Vigna angularis] gb|KOM33874.1| hypothetical protein LR48_Vigan02g002400 [Vigna angularis] dbj|BAT96692.1| hypothetical protein VIGAN_08367100 [Vigna angularis var. angularis] Length = 797 Score = 75.1 bits (183), Expect = 3e-13 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALS 139 PDDFTFRAL ++L N GV K+ +GRLEVM K+D+PHGLQ WMLALS Sbjct: 741 PDDFTFRALANILLNCGVSKRAVGRLEVMVKRDSPHGLQGWMLALS 786 >ref|XP_020204163.1| pentatricopeptide repeat-containing protein At3g23020-like [Cajanus cajan] Length = 807 Score = 75.1 bits (183), Expect = 3e-13 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRAL H+L N G Q +GRLEVM K+D P GLQAWMLALS V E Sbjct: 751 PDDFTFRALAHILLNCGASNQAVGRLEVMVKRDAPGGLQAWMLALSSVYE 800 >ref|XP_016169922.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020965870.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020965871.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020965872.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020965873.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020965874.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] Length = 825 Score = 74.7 bits (182), Expect = 5e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEV 154 PDDFTFRALG L N+GV KQ IGRLEVM KKD P+ LQ WML LS VL + Sbjct: 770 PDDFTFRALGQCLLNYGVSKQDIGRLEVMVKKDAPNALQEWMLMLSSVLGI 820 >ref|XP_014511155.1| pentatricopeptide repeat-containing protein At3g23020 [Vigna radiata var. radiata] ref|XP_014511157.1| pentatricopeptide repeat-containing protein At3g23020 [Vigna radiata var. radiata] Length = 797 Score = 73.9 bits (180), Expect = 9e-13 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALS 139 PDDFTFRAL ++L N GV K+ +GRLEVM K+D+PHGLQ WM+ALS Sbjct: 741 PDDFTFRALANILLNCGVSKRAVGRLEVMVKRDSPHGLQGWMVALS 786 >ref|XP_016183113.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_016183114.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_016183115.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_016183116.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_016183118.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_016183119.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971237.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971238.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971239.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971240.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971241.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971242.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] ref|XP_020971243.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis ipaensis] Length = 824 Score = 72.4 bits (176), Expect = 3e-12 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEV 154 PDDFTF ALG L N+GV KQ IGRLEVM KKD P+ LQ WML LS VL + Sbjct: 769 PDDFTFSALGQCLLNYGVSKQDIGRLEVMVKKDAPNALQEWMLMLSSVLGI 819 >ref|XP_015948661.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_015948662.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990720.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990721.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990722.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990723.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990724.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990725.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990726.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990727.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] ref|XP_020990728.1| pentatricopeptide repeat-containing protein At3g23020 [Arachis duranensis] Length = 825 Score = 71.2 bits (173), Expect = 8e-12 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEV 154 PDDFTF ALG L N+GV KQ IG+LEVM KKD P+ LQ WML LS VL + Sbjct: 770 PDDFTFSALGQCLLNYGVSKQDIGKLEVMVKKDAPNALQEWMLMLSSVLGI 820 >ref|XP_007148597.1| hypothetical protein PHAVU_006G222000g [Phaseolus vulgaris] gb|ESW20591.1| hypothetical protein PHAVU_006G222000g [Phaseolus vulgaris] Length = 661 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRAL ++L N GV K +GRLEVM K+D HGLQ WMLALS E Sbjct: 605 PDDFTFRALANILLNCGVSKGAVGRLEVMVKRDAHHGLQGWMLALSCAYE 654 >ref|XP_007148598.1| hypothetical protein PHAVU_006G222000g [Phaseolus vulgaris] gb|ESW20592.1| hypothetical protein PHAVU_006G222000g [Phaseolus vulgaris] Length = 804 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDDFTFRAL ++L N GV K +GRLEVM K+D HGLQ WMLALS E Sbjct: 748 PDDFTFRALANILLNCGVSKGAVGRLEVMVKRDAHHGLQGWMLALSCAYE 797 >ref|XP_010051882.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Eucalyptus grandis] ref|XP_010051883.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020 [Eucalyptus grandis] gb|KCW75719.1| hypothetical protein EUGRSUZ_D00099 [Eucalyptus grandis] Length = 859 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLE 151 PDD TF++LGHVL +GV K +G+LEV+AKKD G+QAWM A+S V++ Sbjct: 805 PDDSTFKSLGHVLMKYGVSKHAVGKLEVLAKKDAQRGVQAWMSAISTVVD 854 >gb|PRQ36223.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 116 Score = 62.8 bits (151), Expect = 4e-10 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = +2 Query: 2 PDDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEVME 160 PDD TF++LG VL G+ KQ +G+LEV KKD+ GLQAWM ALS V+ V E Sbjct: 60 PDDCTFKSLGLVLLKSGLSKQAVGKLEVSVKKDSGTGLQAWMSALSAVVRVNE 112 >ref|XP_007144179.1| hypothetical protein PHAVU_007G135000g [Phaseolus vulgaris] gb|ESW16173.1| hypothetical protein PHAVU_007G135000g [Phaseolus vulgaris] Length = 823 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/50 (60%), Positives = 42/50 (84%) Frame = +2 Query: 5 DDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEV 154 D+ +FR+LG++L +GV +Q++G+LEV+AKK +GLQAWMLALS VLEV Sbjct: 768 DNCSFRSLGNLLLRYGVSRQSVGKLEVLAKKGASNGLQAWMLALSSVLEV 817 >ref|XP_017434411.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020-like [Vigna angularis] gb|KOM52403.1| hypothetical protein LR48_Vigan09g106200 [Vigna angularis] dbj|BAT94654.1| hypothetical protein VIGAN_08127500 [Vigna angularis var. angularis] Length = 823 Score = 62.8 bits (151), Expect = 7e-09 Identities = 28/50 (56%), Positives = 39/50 (78%) Frame = +2 Query: 5 DDFTFRALGHVLQNFGVQKQTIGRLEVMAKKDNPHGLQAWMLALSRVLEV 154 D+F+FR+LG++L +GV +Q +G+LEV+ KKD +GL AWM AL VLEV Sbjct: 768 DNFSFRSLGNLLLRYGVSRQAVGKLEVLVKKDASNGLPAWMSALESVLEV 817