BLASTX nr result
ID: Astragalus24_contig00016588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016588 (311 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498428.1| PREDICTED: uncharacterized protein At1g21580... 75 2e-13 >ref|XP_004498428.1| PREDICTED: uncharacterized protein At1g21580 [Cicer arietinum] Length = 2014 Score = 74.7 bits (182), Expect = 2e-13 Identities = 38/93 (40%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = -1 Query: 281 ISYRTIHTXXXXXXXXXXPDK-SRNFPLYPHRPIEEERSLSSVSNHHAFSNRNDLLPRRV 105 +SY TIHT P +P PIEEER ND LPRR+ Sbjct: 43 LSYHTIHTPPLPPPPPPYNPPLPHQSPQFPFYPIEEER--------------NDHLPRRI 88 Query: 104 IHEPAWNPSPDDRVSRKHPPPDFNRESHHHQHH 6 + E WNP+PDDR +R +PP D++R+SHHH H+ Sbjct: 89 VPESPWNPNPDDRSTRNYPPIDYDRDSHHHHHN 121