BLASTX nr result
ID: Astragalus24_contig00016558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016558 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013463048.1| F-box protein interaction domain protein [Me... 64 5e-09 ref|XP_013463051.1| F-box protein interaction domain protein [Me... 62 2e-08 ref|XP_013463054.1| F-box protein interaction domain protein [Me... 60 1e-07 ref|XP_013468332.1| F-box protein interaction domain protein [Me... 60 2e-07 ref|XP_013463143.1| F-box protein interaction domain protein [Me... 59 4e-07 ref|XP_013463137.1| F-box protein interaction domain protein [Me... 59 4e-07 gb|ABO80944.1| Cyclin-like F-box; F-box protein interaction doma... 55 6e-07 gb|ABD28491.2| Cyclin-like F-box; F-box protein interaction doma... 55 1e-06 ref|XP_013468330.1| F-box protein interaction domain protein [Me... 56 3e-06 ref|XP_003594188.1| F-box and associated interaction domain prot... 56 3e-06 ref|XP_003594190.2| PPR domain protein [Medicago truncatula] >gi... 55 3e-06 ref|XP_003546182.1| PREDICTED: F-box protein CPR30-like [Glycine... 55 6e-06 ref|XP_003594235.2| F-box protein interaction domain protein [Me... 55 7e-06 ref|XP_013441647.1| F-box protein interaction domain protein [Me... 55 9e-06 >ref|XP_013463048.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH37093.1| F-box protein interaction domain protein [Medicago truncatula] Length = 385 Score = 64.3 bits (155), Expect = 5e-09 Identities = 42/81 (51%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW KLFTLMES F+ L PLGY SD KVL N +L WY+LKS+Q S+V + Sbjct: 287 DSWCKLFTLMES---CFVLPLKSLSPLGYSSDGKKVLLDLNHKKLVWYDLKSEQFSYV-D 342 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P F A+I + SLV P FP Sbjct: 343 GIPKFDEAMICVGSLVPPSFP 363 >ref|XP_013463051.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH37096.1| F-box protein interaction domain protein [Medicago truncatula] Length = 389 Score = 62.4 bits (150), Expect = 2e-08 Identities = 39/81 (48%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW KLFTLM S F+ + PLGY SD K+LF+ N +L WY+LKS++V++ I Sbjct: 284 DSWCKLFTLMGS---CFVLPVISLIPLGYSSDGKKLLFEVNHKKLVWYDLKSEEVNY-IE 339 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P F A+I + SLV P FP Sbjct: 340 GIPNFDEAMICVGSLVLPSFP 360 >ref|XP_013463054.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH37099.1| F-box protein interaction domain protein [Medicago truncatula] Length = 396 Score = 60.5 bits (145), Expect = 1e-07 Identities = 41/82 (50%), Positives = 48/82 (58%), Gaps = 1/82 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW KLFTLMES F+ PLGY SD KVL N L WY+LKS+QVS+V Sbjct: 291 DSWCKLFTLMES---CFVLPFRFLSPLGYSSDGKKVLLDVNHNMLVWYDLKSQQVSYV-E 346 Query: 178 PWPFFQPAIIWMESLVQPPFPS 243 P F A+I + SLV P P+ Sbjct: 347 GIPNFDEAMICVGSLVPPSLPA 368 >ref|XP_013468332.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH42369.1| F-box protein interaction domain protein [Medicago truncatula] Length = 380 Score = 59.7 bits (143), Expect = 2e-07 Identities = 38/81 (46%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW +LFTL ES F+ L +PL Y SD VL + + +LFWY+LKS+QVS + Sbjct: 282 DSWCELFTLAES---CFILPLKTLWPLAYSSDGSMVLLEVDCEKLFWYDLKSEQVS-CVE 337 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P F A+I + SLV P FP Sbjct: 338 GIPNFDQAMICVGSLVPPSFP 358 >ref|XP_013463143.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH36957.1| F-box protein interaction domain protein [Medicago truncatula] Length = 401 Score = 58.9 bits (141), Expect = 4e-07 Identities = 39/81 (48%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW KLFT+++S L SL PLGY SD KVL + + +LFWY+LKS QVS+V Sbjct: 305 DSWCKLFTMVKSCYDLPLKSLR---PLGYSSDGKKVLLRVDAEKLFWYDLKSAQVSYV-E 360 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P F + + SLV P FP Sbjct: 361 GIPDFHGVMFCVGSLVPPSFP 381 >ref|XP_013463137.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH36951.1| F-box protein interaction domain protein [Medicago truncatula] Length = 411 Score = 58.9 bits (141), Expect = 4e-07 Identities = 39/81 (48%), Positives = 50/81 (61%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHVIN 177 DSW K+FTL++S L SL PLGY SD KVL + + +L WY+LKS+QV +V Sbjct: 304 DSWCKIFTLVKSRFTLRLKSLR---PLGYSSDGSKVLLEIDCKKLVWYDLKSEQVIYV-E 359 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P A+I +ESLV P FP Sbjct: 360 GIPNLDEAMICVESLVPPSFP 380 >gb|ABO80944.1| Cyclin-like F-box; F-box protein interaction domain; Galactose oxidase, central, putative [Medicago truncatula] Length = 114 Score = 55.5 bits (132), Expect = 6e-07 Identities = 40/89 (44%), Positives = 48/89 (53%), Gaps = 9/89 (10%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSDM-KVLFKTNL--------YELFWYNLKS 153 DSW KLFTL++S F L PL Y SD KVL TN ++LFWY+ KS Sbjct: 23 DSWCKLFTLVKS---WFNFHLVSLRPLCYSSDQRKVLLATNHASYLFVNPWKLFWYDFKS 79 Query: 154 KQVSHVINPWPFFQPAIIWMESLVQPPFP 240 +QV+HV P F +I ESLV P P Sbjct: 80 EQVTHV-QGIPTFNEVMICAESLVSPSLP 107 >gb|ABD28491.2| Cyclin-like F-box; F-box protein interaction domain; Galactose oxidase, central, putative [Medicago truncatula] Length = 150 Score = 55.5 bits (132), Expect = 1e-06 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 8/88 (9%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD--------MKVLFKTNLYELFWYNLKSK 156 DSW KLFTL++S F + L + PLGY D ++VL + + +LFWY+LKS+ Sbjct: 33 DSWCKLFTLVKS---CFHSHLTASRPLGYSGDGSKVLLEAIEVLLEVDHQKLFWYDLKSE 89 Query: 157 QVSHVINPWPFFQPAIIWMESLVQPPFP 240 QV +V P + +I +ESLV FP Sbjct: 90 QVIYV-EGVPNWNDTVICVESLVPTSFP 116 >ref|XP_013468330.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH42367.1| F-box protein interaction domain protein [Medicago truncatula] Length = 377 Score = 56.2 bits (134), Expect = 3e-06 Identities = 40/81 (49%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSDMK-VLFKTNLYELFWYNLKSKQVSHVIN 177 DSW KLFTL ES F L LGY SD VL + + +LFWY+LKS+ VS+V Sbjct: 285 DSWCKLFTLAES---CFSLPLRALRILGYSSDRSMVLLQVDREKLFWYDLKSECVSYV-E 340 Query: 178 PWPFFQPAIIWMESLVQPPFP 240 P AII + SLVQP FP Sbjct: 341 GIPRVDHAIICVGSLVQPSFP 361 >ref|XP_003594188.1| F-box and associated interaction domain protein [Medicago truncatula] gb|ABD28492.1| Cyclin-like F-box; F-box protein interaction domain; Galactose oxidase, central [Medicago truncatula] gb|AES64439.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 424 Score = 56.2 bits (134), Expect = 3e-06 Identities = 42/87 (48%), Positives = 53/87 (60%), Gaps = 7/87 (8%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSDM-KVLFKTN------LYELFWYNLKSKQ 159 DSW KLFTL++S S L+ L PL Y SD KVL + N L +LFWY+LKS+Q Sbjct: 314 DSWCKLFTLVKSCFNSPLDFLR---PLCYSSDGGKVLLEANPNLDKTLRKLFWYDLKSEQ 370 Query: 160 VSHVINPWPFFQPAIIWMESLVQPPFP 240 VS+V P F A+ ++ SLV P FP Sbjct: 371 VSYV-EGIPNFDEAMFYVGSLVSPFFP 396 >ref|XP_003594190.2| PPR domain protein [Medicago truncatula] gb|AES64441.2| PPR domain protein [Medicago truncatula] Length = 228 Score = 55.5 bits (132), Expect = 3e-06 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 8/88 (9%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD--------MKVLFKTNLYELFWYNLKSK 156 DSW KLFTL++S F + L + PLGY D ++VL + + +LFWY+LKS+ Sbjct: 33 DSWCKLFTLVKS---CFHSHLTASRPLGYSGDGSKVLLEAIEVLLEVDHQKLFWYDLKSE 89 Query: 157 QVSHVINPWPFFQPAIIWMESLVQPPFP 240 QV +V P + +I +ESLV FP Sbjct: 90 QVIYV-EGVPNWNDTVICVESLVPTSFP 116 >ref|XP_003546182.1| PREDICTED: F-box protein CPR30-like [Glycine max] gb|KRH11533.1| hypothetical protein GLYMA_15G115100 [Glycine max] gb|KRH11534.1| hypothetical protein GLYMA_15G115100 [Glycine max] Length = 394 Score = 55.5 bits (132), Expect = 6e-06 Identities = 38/81 (46%), Positives = 48/81 (59%), Gaps = 2/81 (2%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKTNLYELFWYNLKSKQVSHV-I 174 DSW K+FTL ES EM SL PLGY SD KVL + + LFWY+L+ K+V+ V I Sbjct: 284 DSWCKVFTLEESREM---RSLKCVRPLGYSSDGNKVLLEHDRKRLFWYDLEKKEVALVKI 340 Query: 175 NPWPFFQPAIIWMESLVQPPF 237 P A+I + +LV P F Sbjct: 341 QGLPNLNEAMICLGTLVPPYF 361 >ref|XP_003594235.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES64486.2| F-box protein interaction domain protein [Medicago truncatula] Length = 311 Score = 55.1 bits (131), Expect = 7e-06 Identities = 42/88 (47%), Positives = 46/88 (52%), Gaps = 8/88 (9%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD-MKVLFKT-------NLYELFWYNLKSK 156 DSW KLFTLME FL L PL Y SD KVL + N L WY+LKS+ Sbjct: 207 DSWCKLFTLMEP---CFLVDLEIFRPLCYSSDGSKVLLEGIHVSTEGNNRNLIWYDLKSE 263 Query: 157 QVSHVINPWPFFQPAIIWMESLVQPPFP 240 QVS V P F IIW+ S V P FP Sbjct: 264 QVSFV-KGIPNFNGTIIWVGSFVPPSFP 290 >ref|XP_013441647.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH15672.1| F-box protein interaction domain protein [Medicago truncatula] Length = 409 Score = 55.1 bits (131), Expect = 9e-06 Identities = 38/88 (43%), Positives = 51/88 (57%), Gaps = 8/88 (9%) Frame = +1 Query: 1 DSWFKLFTLMESPEMSFLNSLYGAYPLGYYSD--------MKVLFKTNLYELFWYNLKSK 156 DSW KLFT+M+S S L S + PL Y SD ++VL + + +LFWY+LK++ Sbjct: 298 DSWCKLFTMMKSCVTSHLKS---SSPLCYSSDGSKVLIEGIEVLLEVHHKKLFWYDLKTE 354 Query: 157 QVSHVINPWPFFQPAIIWMESLVQPPFP 240 QVS+ P F A I + SLV P FP Sbjct: 355 QVSY--EEIPDFNGAKICVGSLVPPSFP 380