BLASTX nr result
ID: Astragalus24_contig00016293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016293 (293 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU02725.1| hypothetical protein BC332_27976 [Capsicum chinense] 53 5e-06 >gb|PHU02725.1| hypothetical protein BC332_27976 [Capsicum chinense] Length = 258 Score = 53.1 bits (126), Expect = 5e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +1 Query: 88 SSGKTSIAEAAAVAMLTTTRRIFYRTHLKASSNHQYLEFW 207 SSGKT IAEAAAVA + RRIFY T LKA SN ++ EFW Sbjct: 215 SSGKTLIAEAAAVATVARGRRIFYTTPLKALSNQKFREFW 254