BLASTX nr result
ID: Astragalus24_contig00016257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016257 (341 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004514422.1| PREDICTED: ATP-dependent RNA helicase SUV3L,... 63 4e-09 ref|XP_004507255.1| PREDICTED: ATP-dependent RNA helicase SUV3L,... 63 5e-09 ref|XP_004489388.1| PREDICTED: ATP-dependent RNA helicase SUV3L,... 61 2e-08 >ref|XP_004514422.1| PREDICTED: ATP-dependent RNA helicase SUV3L, mitochondrial-like [Cicer arietinum] ref|XP_012575337.1| PREDICTED: ATP-dependent RNA helicase SUV3L, mitochondrial-like [Cicer arietinum] Length = 451 Score = 62.8 bits (151), Expect = 4e-09 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -3 Query: 153 MARGPASSLFHLCTRKRRTFSNFKALLFNQN--TSPPSQFHSSLNPFRPFSTH 1 MA+G SSLF+L TRKR TFSN K+LLFN + +S SQFH +PFRPFSTH Sbjct: 1 MAKGSISSLFYLFTRKRTTFSNLKSLLFNHSLTSSSHSQFH---HPFRPFSTH 50 >ref|XP_004507255.1| PREDICTED: ATP-dependent RNA helicase SUV3L, mitochondrial-like [Cicer arietinum] ref|XP_004507256.2| PREDICTED: ATP-dependent RNA helicase SUV3L, mitochondrial-like [Cicer arietinum] Length = 813 Score = 62.8 bits (151), Expect = 5e-09 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -3 Query: 153 MARGPASSLFHLCTRKRRTFSNFKALLFNQN--TSPPSQFHSSLNPFRPFSTH 1 MA+G SSLF+L TRKR TFSN K+LLFN + +S SQFH +PFRPFSTH Sbjct: 1 MAKGSISSLFYLFTRKRTTFSNLKSLLFNHSLTSSSHSQFH---HPFRPFSTH 50 >ref|XP_004489388.1| PREDICTED: ATP-dependent RNA helicase SUV3L, mitochondrial-like [Cicer arietinum] Length = 805 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/53 (62%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -3 Query: 153 MARGPASSLFHLCTRKRRTFSNFKALLFNQN--TSPPSQFHSSLNPFRPFSTH 1 MA+G SSLF+L TRKR TFSN K+L FN + +S SQFH +PFRPFSTH Sbjct: 1 MAKGSISSLFYLFTRKRTTFSNLKSLFFNHSLISSSRSQFH---HPFRPFSTH 50