BLASTX nr result
ID: Astragalus24_contig00016230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00016230 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019415426.1| PREDICTED: probable ubiquitin-like-specific ... 54 9e-06 ref|XP_019415425.1| PREDICTED: probable ubiquitin-like-specific ... 54 9e-06 ref|XP_019415424.1| PREDICTED: probable ubiquitin-like-specific ... 54 9e-06 >ref|XP_019415426.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform X3 [Lupinus angustifolius] Length = 908 Score = 53.9 bits (128), Expect = 9e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = +3 Query: 3 AANIELAVDDLVDIKSQLFQSNETVDGAXXXXXXXXXXXXXXXCISHIEELMIAVVDSNW 182 A ++E AVDDL+DIK QLFQS+ETV S IEEL IAVVDSNW Sbjct: 249 ALDLEWAVDDLIDIKCQLFQSSETVIMKLHVISSNASQSNGVSGTSGIEELEIAVVDSNW 308 Query: 183 S 185 S Sbjct: 309 S 309 >ref|XP_019415425.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform X2 [Lupinus angustifolius] gb|OIV97855.1| hypothetical protein TanjilG_12612 [Lupinus angustifolius] Length = 916 Score = 53.9 bits (128), Expect = 9e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = +3 Query: 3 AANIELAVDDLVDIKSQLFQSNETVDGAXXXXXXXXXXXXXXXCISHIEELMIAVVDSNW 182 A ++E AVDDL+DIK QLFQS+ETV S IEEL IAVVDSNW Sbjct: 246 ALDLEWAVDDLIDIKCQLFQSSETVIMKLHVISSNASQSNGVSGTSGIEELEIAVVDSNW 305 Query: 183 S 185 S Sbjct: 306 S 306 >ref|XP_019415424.1| PREDICTED: probable ubiquitin-like-specific protease 2B isoform X1 [Lupinus angustifolius] Length = 919 Score = 53.9 bits (128), Expect = 9e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = +3 Query: 3 AANIELAVDDLVDIKSQLFQSNETVDGAXXXXXXXXXXXXXXXCISHIEELMIAVVDSNW 182 A ++E AVDDL+DIK QLFQS+ETV S IEEL IAVVDSNW Sbjct: 249 ALDLEWAVDDLIDIKCQLFQSSETVIMKLHVISSNASQSNGVSGTSGIEELEIAVVDSNW 308 Query: 183 S 185 S Sbjct: 309 S 309