BLASTX nr result
ID: Astragalus24_contig00015717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00015717 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIV89426.1| hypothetical protein TanjilG_21901 [Lupinus angus... 54 8e-06 >gb|OIV89426.1| hypothetical protein TanjilG_21901 [Lupinus angustifolius] Length = 154 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +1 Query: 1 QQKYIYERELMAI----QKWQHYLLKRHFMV*TDQTRLQFL 111 QQK +YERELMA+ QKW+HYLL RHF++ TDQ L+FL Sbjct: 112 QQKSVYERELMALVQAAQKWKHYLLGRHFVIRTDQRSLKFL 152