BLASTX nr result
ID: Astragalus24_contig00015706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00015706 (756 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU42912.1| hypothetical protein TSUD_86500 [Trifolium subte... 61 4e-07 gb|PNX93030.1| serine/threonine-protein kinase HT1-like protein ... 61 4e-07 ref|XP_013457026.1| tyrosine kinase family protein [Medicago tru... 60 8e-07 ref|XP_004505066.1| PREDICTED: serine/threonine-protein kinase H... 58 5e-06 >dbj|GAU42912.1| hypothetical protein TSUD_86500 [Trifolium subterraneum] Length = 492 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 121 MDNTNDSWVRRTKFSHTVCHRLDYSRSLTSRSIQPDAVP 5 MD +++SW+RRTKFSHTVCHRLDYSR + S IQPD VP Sbjct: 1 MDESSNSWIRRTKFSHTVCHRLDYSR-IGSFIIQPDVVP 38 >gb|PNX93030.1| serine/threonine-protein kinase HT1-like protein [Trifolium pratense] Length = 493 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 121 MDNTNDSWVRRTKFSHTVCHRLDYSRSLTSRSIQPDAVP 5 MD +++SW+RRTKFSHTVCHRLDYS+ + S IQPDAVP Sbjct: 1 MDESSNSWIRRTKFSHTVCHRLDYSK-VGSFVIQPDAVP 38 >ref|XP_013457026.1| tyrosine kinase family protein [Medicago truncatula] gb|KEH31057.1| tyrosine kinase family protein [Medicago truncatula] Length = 507 Score = 60.5 bits (145), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -3 Query: 121 MDNTNDSWVRRTKFSHTVCHRLDYSRSLTSRSIQPDAVP 5 MD T++SW+RRTKFSHTVCHRLDYSR + S IQ DAVP Sbjct: 1 MDETSNSWLRRTKFSHTVCHRLDYSR-IGSFIIQQDAVP 38 >ref|XP_004505066.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum] Length = 496 Score = 58.2 bits (139), Expect = 5e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 121 MDNTNDSWVRRTKFSHTVCHRLDYSRSLTSRSIQPDAV 8 MD T+ SW+RRTKFSHTVCHRLDYSR + S I+P+AV Sbjct: 1 MDETSSSWIRRTKFSHTVCHRLDYSR-IGSFIIRPEAV 37