BLASTX nr result
ID: Astragalus24_contig00015653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00015653 (316 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154260.1| hypothetical protein PHAVU_003G103800g [Phas... 64 9e-10 ref|XP_016198588.1| transcription termination factor MTERF5, chl... 64 1e-09 ref|XP_015936634.1| uncharacterized protein LOC107462543 [Arachi... 64 1e-09 dbj|GAU11141.1| hypothetical protein TSUD_197650 [Trifolium subt... 62 1e-09 ref|XP_015936645.2| uncharacterized protein LOC107462551 [Arachi... 63 2e-09 ref|XP_013458253.1| hypothetical protein MTR_4g119615 [Medicago ... 59 3e-09 gb|KYP58079.1| hypothetical protein KK1_004370 [Cajanus cajan] 59 4e-09 ref|XP_003609652.2| transcription termination factor family prot... 60 1e-08 gb|PNY04394.1| hypothetical protein L195_g000815 [Trifolium prat... 61 1e-08 dbj|GAU11145.1| hypothetical protein TSUD_197690 [Trifolium subt... 60 2e-08 ref|XP_016198576.1| transcription termination factor MTERF5, chl... 60 3e-08 ref|XP_003609653.2| mTERF protein [Medicago truncatula] >gi|6573... 60 3e-08 dbj|GAU45619.1| hypothetical protein TSUD_301970 [Trifolium subt... 60 3e-08 gb|PNY04392.1| hypothetical protein L195_g000813 [Trifolium prat... 60 4e-08 ref|XP_020226878.1| uncharacterized protein LOC109808335 [Cajanu... 59 7e-08 ref|XP_017408223.1| PREDICTED: uncharacterized protein LOC108321... 59 7e-08 ref|XP_020227813.1| uncharacterized protein LOC109809007 [Cajanu... 59 7e-08 ref|XP_014500314.1| uncharacterized protein LOC106761293 [Vigna ... 59 1e-07 dbj|GAU11144.1| hypothetical protein TSUD_197680 [Trifolium subt... 59 1e-07 ref|XP_014506749.1| uncharacterized protein LOC106766540 [Vigna ... 59 1e-07 >ref|XP_007154260.1| hypothetical protein PHAVU_003G103800g [Phaseolus vulgaris] ref|XP_007154261.1| hypothetical protein PHAVU_003G103800g [Phaseolus vulgaris] gb|ESW26254.1| hypothetical protein PHAVU_003G103800g [Phaseolus vulgaris] gb|ESW26255.1| hypothetical protein PHAVU_003G103800g [Phaseolus vulgaris] Length = 371 Score = 64.3 bits (155), Expect = 9e-10 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 A VVQYL SKGL+KKGASLVTPF ++D++FL +YV RY+ ET R Sbjct: 316 ALVVQYLLSKGLVKKGASLVTPFGMSDEMFLRKYVKRYKEETPR 359 >ref|XP_016198588.1| transcription termination factor MTERF5, chloroplastic-like [Arachis ipaensis] Length = 369 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQYL SKGLMKK ASL TPF LTDK FLERYVTR+E S Sbjct: 315 ALVVQYLLSKGLMKKDASLATPFYLTDKKFLERYVTRFEKHHS 357 >ref|XP_015936634.1| uncharacterized protein LOC107462543 [Arachis duranensis] Length = 369 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQYL SKGLMKK ASL TPF LTDK FLERYVTR+E S Sbjct: 315 ALVVQYLLSKGLMKKDASLATPFYLTDKKFLERYVTRFEKHHS 357 >dbj|GAU11141.1| hypothetical protein TSUD_197650 [Trifolium subterraneum] Length = 198 Score = 62.4 bits (150), Expect = 1e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 ASVVQYL SKGLMKK ASL TPF TD+LFL++YV R++ E R Sbjct: 142 ASVVQYLLSKGLMKKDASLTTPFYFTDELFLQKYVNRFDEEAYR 185 >ref|XP_015936645.2| uncharacterized protein LOC107462551 [Arachis duranensis] Length = 360 Score = 63.2 bits (152), Expect = 2e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYE 117 A VVQYL SKGLMKK ASL TPF LTDK FLERYVTR+E Sbjct: 306 ALVVQYLLSKGLMKKDASLATPFYLTDKKFLERYVTRFE 344 >ref|XP_013458253.1| hypothetical protein MTR_4g119615 [Medicago truncatula] gb|KEH32284.1| hypothetical protein MTR_4g119615 [Medicago truncatula] Length = 94 Score = 59.3 bits (142), Expect = 3e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 ASV+QYL SKGLMKK ASL PF L D+LFL+RYV R+ +E S Sbjct: 33 ASVIQYLLSKGLMKKDASLTAPFYLKDELFLQRYVKRFGDEAS 75 >gb|KYP58079.1| hypothetical protein KK1_004370 [Cajanus cajan] Length = 99 Score = 58.9 bits (141), Expect = 4e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQ+L SKGL+KKGASLVTPFS+ D+ FL++YV ++ ETS Sbjct: 45 ALVVQHLMSKGLLKKGASLVTPFSMLDEAFLQKYVKCFKEETS 87 >ref|XP_003609652.2| transcription termination factor family protein [Medicago truncatula] gb|AES91849.2| transcription termination factor family protein [Medicago truncatula] Length = 232 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 ASV++YL SKGLMKKG+SL TPF TD+ F RYV R+E ETS+ Sbjct: 180 ASVIKYLLSKGLMKKGSSLCTPFHATDEDFQRRYVKRFEEETSK 223 >gb|PNY04394.1| hypothetical protein L195_g000815 [Trifolium pratense] Length = 381 Score = 61.2 bits (147), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 ASVVQYL SKGLMKK ASL+TPF +D++FL+RYV +E E R Sbjct: 320 ASVVQYLLSKGLMKKNASLITPFYCSDQVFLQRYVNNFEEEAYR 363 >dbj|GAU11145.1| hypothetical protein TSUD_197690 [Trifolium subterraneum] Length = 386 Score = 60.5 bits (145), Expect = 2e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 ASVVQYL SKGLMKK ASL TPF +TD++F +RYV R+E + R Sbjct: 319 ASVVQYLLSKGLMKKDASLTTPFYVTDEVFQQRYVNRFEKDAYR 362 >ref|XP_016198576.1| transcription termination factor MTERF5, chloroplastic [Arachis ipaensis] Length = 369 Score = 60.1 bits (144), Expect = 3e-08 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQYL SKGLMKK ASL TPF +T K FLERYVTR+E S Sbjct: 315 ALVVQYLLSKGLMKKDASLATPFFVTHKKFLERYVTRFEKHHS 357 >ref|XP_003609653.2| mTERF protein [Medicago truncatula] gb|AES91850.2| mTERF protein [Medicago truncatula] Length = 377 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENE 123 ASV++YL SKGLMKK ASL PF LTD++FL+RYV R+E E Sbjct: 321 ASVIRYLLSKGLMKKDASLTAPFYLTDEVFLQRYVNRFEEE 361 >dbj|GAU45619.1| hypothetical protein TSUD_301970 [Trifolium subterraneum] Length = 388 Score = 60.1 bits (144), Expect = 3e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A+VVQY+ +KGL+KK ASL PF ++DK+FLERYV RY+ E+S Sbjct: 323 AAVVQYILTKGLLKKNASLTNPFIVSDKVFLERYVNRYKEESS 365 >gb|PNY04392.1| hypothetical protein L195_g000813 [Trifolium pratense] Length = 379 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 ASVVQYL SKGLMKK ASL++PF LTD++F +RY+ R+E + R Sbjct: 318 ASVVQYLLSKGLMKKDASLISPFYLTDEVFRQRYMDRFEEDAYR 361 >ref|XP_020226878.1| uncharacterized protein LOC109808335 [Cajanus cajan] Length = 367 Score = 58.9 bits (141), Expect = 7e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQ+L SKGL+KKGASLVTPFS+ D+ FL++YV ++ ETS Sbjct: 313 ALVVQHLMSKGLLKKGASLVTPFSMLDEAFLQKYVKCFKEETS 355 >ref|XP_017408223.1| PREDICTED: uncharacterized protein LOC108321090 [Vigna angularis] gb|KOM27910.1| hypothetical protein LR48_Vigan468s007200 [Vigna angularis] dbj|BAT80250.1| hypothetical protein VIGAN_02324800 [Vigna angularis var. angularis] Length = 376 Score = 58.9 bits (141), Expect = 7e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQYL KGL K ASL+TPFS++DK+F+E YV R++ ETS Sbjct: 324 AHVVQYLLKKGLRSKSASLITPFSVSDKVFIENYVMRFKEETS 366 >ref|XP_020227813.1| uncharacterized protein LOC109809007 [Cajanus cajan] gb|KYP58066.1| hypothetical protein KK1_004357 [Cajanus cajan] Length = 381 Score = 58.9 bits (141), Expect = 7e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 A+V+ +L S+GL KKGASLVTPF +T+KLFLER+VTR++ + R Sbjct: 324 AAVLHFLASQGLRKKGASLVTPFLVTEKLFLERFVTRFQGHSLR 367 >ref|XP_014500314.1| uncharacterized protein LOC106761293 [Vigna radiata var. radiata] Length = 377 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETS 129 A VVQYL KGL K ASL+TPFS++DK+F+E YV R++ ETS Sbjct: 325 ALVVQYLLKKGLRSKSASLITPFSVSDKVFIENYVMRFKEETS 367 >dbj|GAU11144.1| hypothetical protein TSUD_197680 [Trifolium subterraneum] Length = 386 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENE 123 ASVVQYL SKGL KK ASL+TPF TD+LFL++YV +E E Sbjct: 319 ASVVQYLLSKGLWKKDASLITPFYRTDELFLQKYVNHFEEE 359 >ref|XP_014506749.1| uncharacterized protein LOC106766540 [Vigna radiata var. radiata] Length = 741 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 ASVVQYLRSKGLMKKGASLVTPFSLTDKLFLERYVTRYENETSR 132 A VVQYL SKGL+KK ASL TPF L+D+ FL++YV R+E ET R Sbjct: 316 ALVVQYLLSKGLVKKSASLGTPFVLSDERFLQKYVKRFEEETPR 359