BLASTX nr result
ID: Astragalus24_contig00014965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00014965 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP75811.1| hypothetical protein KK1_020018 [Cajanus cajan] 65 8e-09 >gb|KYP75811.1| hypothetical protein KK1_020018 [Cajanus cajan] Length = 390 Score = 65.1 bits (157), Expect = 8e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 524 RSNFPIFINQSYQTLCEKYPSFRERSENVDLVV 622 R+N P FINQSYQT+CEKYPSFRERSENVDLVV Sbjct: 68 RTNLPTFINQSYQTICEKYPSFRERSENVDLVV 100