BLASTX nr result
ID: Astragalus24_contig00014594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00014594 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615132.2| trypsin-like peptidase domain protein [Medic... 65 1e-09 >ref|XP_003615132.2| trypsin-like peptidase domain protein [Medicago truncatula] gb|AES98090.2| trypsin-like peptidase domain protein [Medicago truncatula] Length = 307 Score = 65.5 bits (158), Expect = 1e-09 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = -3 Query: 190 CGDFVCSSLKKTPDYRILGHIYNVDYFRKFIPARFTFQKKLCALILIIQCAGLRYTEDWG 11 CG +V +SLK TP YRILG ++N +YF +F FQKKL A I IIQC G T+D Sbjct: 170 CGGYVSNSLKTTPTYRILGDMWNANYFATHKEKKFMFQKKLRASIPIIQCVGFSCTDD-A 228 Query: 10 CAG 2 C+G Sbjct: 229 CSG 231