BLASTX nr result
ID: Astragalus24_contig00014584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00014584 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019443411.1| PREDICTED: ubiquinone biosynthesis protein C... 112 5e-28 ref|XP_019443403.1| PREDICTED: ubiquinone biosynthesis protein C... 112 1e-27 gb|PNY14051.1| ubiquinone biosynthesis protein COQ9 [Trifolium p... 111 3e-27 ref|NP_001239658.1| uncharacterized protein LOC100775943 [Glycin... 110 3e-27 dbj|GAU33205.1| hypothetical protein TSUD_206640 [Trifolium subt... 110 4e-27 gb|KHN07888.1| Ubiquinone biosynthesis protein COQ9, mitochondri... 110 4e-27 ref|XP_003542366.1| PREDICTED: ubiquinone biosynthesis protein C... 110 4e-27 ref|XP_019463869.1| PREDICTED: ubiquinone biosynthesis protein C... 108 2e-26 ref|XP_003609983.2| ubiquinone biosynthesis protein COQ9 [Medica... 107 5e-26 ref|XP_016197146.1| ubiquinone biosynthesis protein COQ9-B, mito... 107 8e-26 ref|XP_015931665.1| ubiquinone biosynthesis protein COQ9-B, mito... 107 1e-25 gb|AFK47711.1| unknown [Medicago truncatula] 107 1e-25 gb|AFK44606.1| unknown [Medicago truncatula] >gi|388513379|gb|AF... 107 1e-25 ref|XP_003609982.2| ubiquinone biosynthesis protein COQ9 [Medica... 107 1e-25 ref|XP_007154565.1| hypothetical protein PHAVU_003G129500g [Phas... 105 4e-25 ref|XP_004508011.1| PREDICTED: ubiquinone biosynthesis protein C... 102 5e-24 ref|XP_011039959.1| PREDICTED: ubiquinone biosynthesis protein C... 101 2e-23 ref|XP_006381599.1| hypothetical protein POPTR_0006s14200g [Popu... 101 2e-23 ref|XP_021636541.1| ubiquinone biosynthesis protein coq9, mitoch... 100 2e-23 dbj|BAT76896.1| hypothetical protein VIGAN_01496200 [Vigna angul... 100 2e-23 >ref|XP_019443411.1| PREDICTED: ubiquinone biosynthesis protein COQ9-A, mitochondrial-like isoform X2 [Lupinus angustifolius] Length = 250 Score = 112 bits (279), Expect = 5e-28 Identities = 55/58 (94%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNS QGFVGKVF R Sbjct: 193 MLTDSSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSFQGFVGKVFGR 250 >ref|XP_019443403.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like isoform X1 [Lupinus angustifolius] gb|OIW19348.1| hypothetical protein TanjilG_03482 [Lupinus angustifolius] Length = 304 Score = 112 bits (279), Expect = 1e-27 Identities = 55/58 (94%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNS QGFVGKVF R Sbjct: 247 MLTDSSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSFQGFVGKVFGR 304 >gb|PNY14051.1| ubiquinone biosynthesis protein COQ9 [Trifolium pratense] Length = 308 Score = 111 bits (277), Expect = 3e-27 Identities = 55/58 (94%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS FRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNS QGFVGKVFRR Sbjct: 251 MLTDGSAGFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSFQGFVGKVFRR 308 >ref|NP_001239658.1| uncharacterized protein LOC100775943 [Glycine max] gb|ACU24561.1| unknown [Glycine max] gb|KHN17735.1| Ubiquinone biosynthesis protein COQ9, mitochondrial [Glycine soja] gb|KRH02593.1| hypothetical protein GLYMA_17G048000 [Glycine max] Length = 291 Score = 110 bits (276), Expect = 3e-27 Identities = 53/58 (91%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFD+KKTIQEAQYLAEAVS GLGNS QGFVGKVF+R Sbjct: 234 MLTDSSPDFRDTWAFLDARVKDAFDIKKTIQEAQYLAEAVSTGLGNSFQGFVGKVFQR 291 >dbj|GAU33205.1| hypothetical protein TSUD_206640 [Trifolium subterraneum] Length = 271 Score = 110 bits (274), Expect = 4e-27 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS FRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGN+ QGFVGKVFRR Sbjct: 214 MLTDGSAGFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNTFQGFVGKVFRR 271 >gb|KHN07888.1| Ubiquinone biosynthesis protein COQ9, mitochondrial [Glycine soja] Length = 306 Score = 110 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGNS QGFVGKVF+R Sbjct: 249 MLTDTSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNSFQGFVGKVFQR 306 >ref|XP_003542366.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Glycine max] gb|KRH19340.1| hypothetical protein GLYMA_13G111700 [Glycine max] Length = 306 Score = 110 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGNS QGFVGKVF+R Sbjct: 249 MLTDTSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNSFQGFVGKVFQR 306 >ref|XP_019463869.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like [Lupinus angustifolius] gb|OIV99712.1| hypothetical protein TanjilG_26050 [Lupinus angustifolius] Length = 303 Score = 108 bits (271), Expect = 2e-26 Identities = 53/58 (91%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNS +GFVGK F R Sbjct: 246 MLTDSSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSFKGFVGKAFGR 303 >ref|XP_003609983.2| ubiquinone biosynthesis protein COQ9 [Medicago truncatula] gb|AES92180.2| ubiquinone biosynthesis protein COQ9 [Medicago truncatula] Length = 260 Score = 107 bits (266), Expect = 5e-26 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS DFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGN+ + FVGKVFRR Sbjct: 203 MLTDGSADFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNTFEEFVGKVFRR 260 >ref|XP_016197146.1| ubiquinone biosynthesis protein COQ9-B, mitochondrial [Arachis ipaensis] Length = 299 Score = 107 bits (267), Expect = 8e-26 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAFDLKKTIQEAQ+LAEAVSAGLGN+ QGF+GKV RR Sbjct: 242 MLTDTSPDFRDTWAFLDARVKDAFDLKKTIQEAQHLAEAVSAGLGNTFQGFMGKVLRR 299 >ref|XP_015931665.1| ubiquinone biosynthesis protein COQ9-B, mitochondrial [Arachis duranensis] Length = 297 Score = 107 bits (266), Expect = 1e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTW FLDARVKDAFDLKKTIQEAQ+LAEAVSAGLGN+ QGFVGKV RR Sbjct: 240 MLTDTSPDFRDTWTFLDARVKDAFDLKKTIQEAQHLAEAVSAGLGNTFQGFVGKVLRR 297 >gb|AFK47711.1| unknown [Medicago truncatula] Length = 310 Score = 107 bits (266), Expect = 1e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS DFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGN+ + FVGKVFRR Sbjct: 253 MLTDGSADFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNTFEEFVGKVFRR 310 >gb|AFK44606.1| unknown [Medicago truncatula] gb|AFK44751.1| unknown [Medicago truncatula] Length = 310 Score = 107 bits (266), Expect = 1e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS DFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGN+ + FVGKVFRR Sbjct: 253 MLTDGSADFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNTFEEFVGKVFRR 310 >ref|XP_003609982.2| ubiquinone biosynthesis protein COQ9 [Medicago truncatula] gb|AES92179.2| ubiquinone biosynthesis protein COQ9 [Medicago truncatula] Length = 310 Score = 107 bits (266), Expect = 1e-25 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS DFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVS GLGN+ + FVGKVFRR Sbjct: 253 MLTDGSADFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSTGLGNTFEEFVGKVFRR 310 >ref|XP_007154565.1| hypothetical protein PHAVU_003G129500g [Phaseolus vulgaris] gb|ESW26559.1| hypothetical protein PHAVU_003G129500g [Phaseolus vulgaris] Length = 300 Score = 105 bits (262), Expect = 4e-25 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAF++KKTIQEAQ LAEAVS GLGNS QGFVGKVF+R Sbjct: 243 MLTDNSPDFRDTWAFLDARVKDAFNIKKTIQEAQSLAEAVSVGLGNSFQGFVGKVFQR 300 >ref|XP_004508011.1| PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial isoform X2 [Cicer arietinum] Length = 307 Score = 102 bits (255), Expect = 5e-24 Identities = 50/58 (86%), Positives = 51/58 (87%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTDGS DFRDTWAFLDARVKDAF+LKKTIQE QYL EAV AGLGNS Q F GKVFRR Sbjct: 250 MLTDGSADFRDTWAFLDARVKDAFNLKKTIQEVQYLGEAVGAGLGNSFQEFAGKVFRR 307 >ref|XP_011039959.1| PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Populus euphratica] Length = 313 Score = 101 bits (252), Expect = 2e-23 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLD RVKDAFDLKKTIQEA Y+AEAV AG+GNS QGFV +VF+R Sbjct: 256 MLTDSSPDFRDTWAFLDDRVKDAFDLKKTIQEAMYMAEAVGAGMGNSFQGFVRRVFQR 313 >ref|XP_006381599.1| hypothetical protein POPTR_0006s14200g [Populus trichocarpa] gb|PNT31608.1| hypothetical protein POPTR_006G139800v3 [Populus trichocarpa] Length = 313 Score = 101 bits (252), Expect = 2e-23 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLD RVKDAFDLKKTIQEA Y+AEAV AG+GNS QGFV +VF+R Sbjct: 256 MLTDSSPDFRDTWAFLDDRVKDAFDLKKTIQEAMYMAEAVGAGMGNSFQGFVRRVFQR 313 >ref|XP_021636541.1| ubiquinone biosynthesis protein coq9, mitochondrial-like isoform X3 [Hevea brasiliensis] Length = 266 Score = 100 bits (249), Expect = 2e-23 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFR 183 MLTD SPDFRDTW+FLD RVKDAFD KKTIQEAQYLAEAV AG+GNS+QGFV +VF+ Sbjct: 209 MLTDSSPDFRDTWSFLDDRVKDAFDFKKTIQEAQYLAEAVGAGMGNSLQGFVKRVFQ 265 >dbj|BAT76896.1| hypothetical protein VIGAN_01496200 [Vigna angularis var. angularis] Length = 300 Score = 100 bits (250), Expect = 2e-23 Identities = 49/58 (84%), Positives = 52/58 (89%) Frame = -1 Query: 353 MLTDGSPDFRDTWAFLDARVKDAFDLKKTIQEAQYLAEAVSAGLGNSIQGFVGKVFRR 180 MLTD SPDFRDTWAFLDARVKDAF++KKTIQEAQ LAEAVS GLGNS QGF GK F+R Sbjct: 243 MLTDSSPDFRDTWAFLDARVKDAFNIKKTIQEAQSLAEAVSVGLGNSFQGFFGKGFQR 300