BLASTX nr result
ID: Astragalus24_contig00014445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00014445 (308 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004501663.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 55 1e-06 ref|XP_013454810.1| F-box/RNI superfamily protein, putative [Med... 54 3e-06 ref|XP_004501664.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 53 7e-06 ref|XP_003604538.2| F-box/RNI superfamily protein, putative [Med... 53 7e-06 gb|PNX81759.1| F-box family protein [Trifolium pratense] 53 1e-05 dbj|GAU46933.1| hypothetical protein TSUD_85330 [Trifolium subte... 53 1e-05 dbj|GAU32504.1| hypothetical protein TSUD_317110 [Trifolium subt... 53 1e-05 >ref|XP_004501663.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Cicer arietinum] Length = 406 Score = 55.5 bits (132), Expect = 1e-06 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +2 Query: 2 LKSLKV---ELYYHQKYTSRWNVLAGGMSWKENAKLREAIKARTEPYSYIPDGMLDFLLR 172 LKSLKV E+ Y + T R L S KE A +R+A KA EP S IPDG++DFLL+ Sbjct: 329 LKSLKVKMEEISYGFRLTLRDAKLRKAKSQKEAAWIRKAFKAGLEPSSLIPDGVVDFLLQ 388 Query: 173 NSPSTKVDLL 202 NS S +VD + Sbjct: 389 NSRSAEVDFV 398 >ref|XP_013454810.1| F-box/RNI superfamily protein, putative [Medicago truncatula] gb|KEH28841.1| F-box/RNI superfamily protein, putative [Medicago truncatula] Length = 408 Score = 54.3 bits (129), Expect = 3e-06 Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 3/78 (3%) Frame = +2 Query: 2 LKSLKV---ELYYHQKYTSRWNVLAGGMSWKENAKLREAIKARTEPYSYIPDGMLDFLLR 172 LKSLKV EL Y + T R L S +E A++R+A K EP S +PDG++DFL + Sbjct: 330 LKSLKVRMEELLYGFRMTLRDIKLQNAKSKREAARIRKAFKEGLEPPSPVPDGIVDFLCQ 389 Query: 173 NSPSTKVDLLIPERSNGY 226 NSP +VD + R Y Sbjct: 390 NSPLVEVDYIKCRRRQRY 407 >ref|XP_004501664.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g78750-like [Cicer arietinum] Length = 409 Score = 53.1 bits (126), Expect = 7e-06 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 3/78 (3%) Frame = +2 Query: 2 LKSLKVE---LYYHQKYTSRWNVLAGGMSWKENAKLREAIKARTEPYSYIPDGMLDFLLR 172 LKSLKV+ L Y + + L S KE A+L +A KA EP S IP+G+++FLL+ Sbjct: 329 LKSLKVKMKPLSYELRKILVYTKLQKIKSRKEAAELEKAYKAGLEPSSIIPEGIVEFLLQ 388 Query: 173 NSPSTKVDLLIPERSNGY 226 NSPS +VD++ SN + Sbjct: 389 NSPSAEVDIVDWSWSNAH 406 >ref|XP_003604538.2| F-box/RNI superfamily protein, putative [Medicago truncatula] gb|AES86735.2| F-box/RNI superfamily protein, putative [Medicago truncatula] Length = 463 Score = 53.1 bits (126), Expect = 7e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = +2 Query: 2 LKSLKV---ELYYHQKYTSRWNVLAGGMSWKENAKLREAIKARTEPYSYIPDGMLDFLLR 172 LKSLKV EL Y + T R L S +E A++R+A K EP S +PDG++DFL + Sbjct: 330 LKSLKVRMEELLYGFRMTLRDIKLQNAKSKREAARIRKAFKEGLEPPSPVPDGIVDFLCQ 389 Query: 173 NSPSTKVDLL 202 NSP +VD + Sbjct: 390 NSPLVEVDYI 399 >gb|PNX81759.1| F-box family protein [Trifolium pratense] Length = 393 Score = 52.8 bits (125), Expect = 1e-05 Identities = 31/68 (45%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 2 LKSLKVELYYHQKYTSRWNVLAGGMSWK-ENAKLREAIKARTEPYSYIPDGMLDFLLRNS 178 LKSLKV+L L+ G+S AKL++ +KA +EP S IPDG++DFL++NS Sbjct: 332 LKSLKVQL----------KPLSYGLSMTLRTAKLQKEVKAGSEPSSPIPDGIVDFLIQNS 381 Query: 179 PSTKVDLL 202 PS +VD++ Sbjct: 382 PSAEVDII 389 >dbj|GAU46933.1| hypothetical protein TSUD_85330 [Trifolium subterraneum] Length = 393 Score = 52.8 bits (125), Expect = 1e-05 Identities = 31/68 (45%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 2 LKSLKVELYYHQKYTSRWNVLAGGMSWK-ENAKLREAIKARTEPYSYIPDGMLDFLLRNS 178 LKSLKV+L L+ G+S AKL++ +KA +EP S IPDG++DFL++NS Sbjct: 332 LKSLKVQL----------KPLSYGLSMTLRTAKLQKEVKAGSEPSSPIPDGIVDFLIQNS 381 Query: 179 PSTKVDLL 202 PS +VD++ Sbjct: 382 PSAEVDII 389 >dbj|GAU32504.1| hypothetical protein TSUD_317110 [Trifolium subterraneum] Length = 418 Score = 52.8 bits (125), Expect = 1e-05 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = +2 Query: 2 LKSLKV---ELYYHQKYTSRWNVLAGGMSWKENAKLREAIKARTEPYSYIPDGMLDFLLR 172 LKSL V EL Y + T L S +E A++R+A KA EP S IPDG++DFL++ Sbjct: 337 LKSLIVIVDELKYGLRMTLMDVKLQKAKSKREAARIRKAFKAGLEPSSPIPDGIVDFLIQ 396 Query: 173 NSPSTKVDLL 202 NSP KVD + Sbjct: 397 NSPFAKVDFI 406