BLASTX nr result
ID: Astragalus24_contig00014179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00014179 (606 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY13339.1| ferritin-2 [Trifolium pratense] 114 2e-27 dbj|GAU18132.1| hypothetical protein TSUD_248330 [Trifolium subt... 112 7e-27 gb|KRH57950.1| hypothetical protein GLYMA_05G095400 [Glycine max] 107 7e-27 ref|XP_020226431.1| ferritin-3, chloroplastic [Cajanus cajan] 112 7e-27 gb|KRG97687.1| hypothetical protein GLYMA_18G024600 [Glycine max] 112 8e-27 ref|NP_001241944.1| ferritin-3, chloroplastic-like [Glycine max]... 112 8e-27 ref|XP_004491012.1| PREDICTED: ferritin-4, chloroplastic [Cicer ... 112 9e-27 ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] >gi|... 112 1e-26 gb|AFO70135.1| ferritin Fer11;1 [Glycine max] 112 1e-26 gb|OMO75939.1| Ferritin [Corchorus olitorius] 111 2e-26 gb|OMO50043.1| Ferritin [Corchorus capsularis] 111 2e-26 ref|XP_020226236.1| ferritin-2, chloroplastic [Cajanus cajan] >g... 109 7e-26 gb|KHN48588.1| Ferritin-4, chloroplastic [Glycine soja] 106 8e-26 gb|AFO70137.1| ferritin Fer18;1 [Glycine max] 108 1e-25 ref|XP_007141737.1| hypothetical protein PHAVU_008G221200g [Phas... 108 2e-25 gb|ACJ85132.1| unknown [Medicago truncatula] 108 2e-25 ref|XP_003616685.1| ferritin [Medicago truncatula] >gi|355518020... 108 2e-25 ref|XP_015944264.1| ferritin-3, chloroplastic [Arachis duranensis] 108 3e-25 sp|Q41709.2|FRI2_VIGUN RecName: Full=Ferritin-2, chloroplastic; ... 107 4e-25 ref|XP_014504774.1| ferritin-2, chloroplastic [Vigna radiata var... 107 4e-25 >gb|PNY13339.1| ferritin-2 [Trifolium pratense] Length = 255 Score = 114 bits (284), Expect = 2e-27 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASK GDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLL EEAAA Sbjct: 196 VASKTGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLAEEAAA 254 >dbj|GAU18132.1| hypothetical protein TSUD_248330 [Trifolium subterraneum] Length = 255 Score = 112 bits (280), Expect = 7e-27 Identities = 56/59 (94%), Positives = 56/59 (94%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASK GDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LL EEAAA Sbjct: 196 VASKTGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLEEEAAA 254 >gb|KRH57950.1| hypothetical protein GLYMA_05G095400 [Glycine max] Length = 89 Score = 107 bits (267), Expect = 7e-27 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASK+ D QL+DF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 25 VASKSNDAQLSDFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 83 >ref|XP_020226431.1| ferritin-3, chloroplastic [Cajanus cajan] Length = 244 Score = 112 bits (279), Expect = 7e-27 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 185 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 243 >gb|KRG97687.1| hypothetical protein GLYMA_18G024600 [Glycine max] Length = 248 Score = 112 bits (279), Expect = 8e-27 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 189 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 247 >ref|NP_001241944.1| ferritin-3, chloroplastic-like [Glycine max] gb|ACU23985.1| unknown [Glycine max] Length = 248 Score = 112 bits (279), Expect = 8e-27 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 189 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 247 >ref|XP_004491012.1| PREDICTED: ferritin-4, chloroplastic [Cicer arietinum] Length = 254 Score = 112 bits (279), Expect = 9e-27 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKNGDVQL DFVESEFLGEQVEAIKKISE+VAQLRRVGKGHGVWHFDQ LL+EEAAA Sbjct: 195 VASKNGDVQLTDFVESEFLGEQVEAIKKISEFVAQLRRVGKGHGVWHFDQMLLNEEAAA 253 >ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] sp|Q948P6.1|FRI3_SOYBN RecName: Full=Ferritin-3, chloroplastic; AltName: Full=SFerH-3; Flags: Precursor dbj|BAB64536.1| ferritin [Glycine max] gb|KHN04783.1| Ferritin-3, chloroplastic [Glycine soja] gb|KRH31181.1| hypothetical protein GLYMA_11G232600 [Glycine max] Length = 256 Score = 112 bits (279), Expect = 1e-26 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 197 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 255 >gb|AFO70135.1| ferritin Fer11;1 [Glycine max] Length = 256 Score = 112 bits (279), Expect = 1e-26 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 197 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 255 >gb|OMO75939.1| Ferritin [Corchorus olitorius] Length = 269 Score = 111 bits (278), Expect = 2e-26 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAA 433 VA +NGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 210 VADRNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEEA 267 >gb|OMO50043.1| Ferritin [Corchorus capsularis] Length = 271 Score = 111 bits (278), Expect = 2e-26 Identities = 54/58 (93%), Positives = 55/58 (94%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAA 433 VA +NGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEE A Sbjct: 212 VADRNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEEA 269 >ref|XP_020226236.1| ferritin-2, chloroplastic [Cajanus cajan] gb|KYP73089.1| hypothetical protein KK1_005702 [Cajanus cajan] Length = 255 Score = 109 bits (273), Expect = 7e-26 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VA+KNGDVQLADFVESEFLGEQVEAIK++SEYVAQLRRVGKGHGVWHFDQ LLHE AA Sbjct: 197 VANKNGDVQLADFVESEFLGEQVEAIKRLSEYVAQLRRVGKGHGVWHFDQMLLHEGHAA 255 >gb|KHN48588.1| Ferritin-4, chloroplastic [Glycine soja] Length = 147 Score = 106 bits (265), Expect = 8e-26 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHE 442 VA+KNGDVQLADFVE+E+LGEQVEAIK+ISEYVAQLRRVGKGHGVWHFDQ LLHE Sbjct: 88 VATKNGDVQLADFVETEYLGEQVEAIKRISEYVAQLRRVGKGHGVWHFDQMLLHE 142 >gb|AFO70137.1| ferritin Fer18;1 [Glycine max] Length = 248 Score = 108 bits (271), Expect = 1e-25 Identities = 53/59 (89%), Positives = 54/59 (91%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRV KGHGVWHFDQ LLHEE A Sbjct: 189 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVRKGHGVWHFDQMLLHEEGVA 247 >ref|XP_007141737.1| hypothetical protein PHAVU_008G221200g [Phaseolus vulgaris] gb|ESW13731.1| hypothetical protein PHAVU_008G221200g [Phaseolus vulgaris] Length = 247 Score = 108 bits (270), Expect = 2e-25 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEA 436 VA+KNGDVQL DFVESEFLGEQVEAIK+ISEYVAQLRRVGKGHGVWHFDQ LLHE A Sbjct: 191 VATKNGDVQLTDFVESEFLGEQVEAIKRISEYVAQLRRVGKGHGVWHFDQMLLHEAA 247 >gb|ACJ85132.1| unknown [Medicago truncatula] Length = 249 Score = 108 bits (270), Expect = 2e-25 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASK GDV LADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LL+E AAA Sbjct: 191 VASKTGDVNLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNEAAAA 249 >ref|XP_003616685.1| ferritin [Medicago truncatula] gb|AES99643.1| ferritin [Medicago truncatula] gb|AFK33655.1| unknown [Medicago truncatula] Length = 249 Score = 108 bits (270), Expect = 2e-25 Identities = 54/59 (91%), Positives = 55/59 (93%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASK GDV LADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LL+E AAA Sbjct: 191 VASKTGDVNLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNEAAAA 249 >ref|XP_015944264.1| ferritin-3, chloroplastic [Arachis duranensis] Length = 262 Score = 108 bits (269), Expect = 3e-25 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHEEAAA 430 VASKN DVQLADF+ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLH + A Sbjct: 203 VASKNNDVQLADFIESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHGDGVA 261 >sp|Q41709.2|FRI2_VIGUN RecName: Full=Ferritin-2, chloroplastic; Flags: Precursor gb|AAC06027.1| ferritin subunit cowpea2 precursor [Vigna unguiculata] Length = 250 Score = 107 bits (268), Expect = 4e-25 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHE 442 VA+KNGDVQLADFVESEFLGEQVE+IK+ISEYVAQLRRVGKGHGVWHFDQ LLHE Sbjct: 191 VATKNGDVQLADFVESEFLGEQVESIKRISEYVAQLRRVGKGHGVWHFDQMLLHE 245 >ref|XP_014504774.1| ferritin-2, chloroplastic [Vigna radiata var. radiata] Length = 250 Score = 107 bits (268), Expect = 4e-25 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 606 VASKNGDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQTLLHE 442 VA+KNGDVQLADFVESEFLGEQVE+IK+ISEYVAQLRRVGKGHGVWHFDQ LLHE Sbjct: 191 VATKNGDVQLADFVESEFLGEQVESIKRISEYVAQLRRVGKGHGVWHFDQMLLHE 245