BLASTX nr result
ID: Astragalus24_contig00013546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00013546 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44134.1| hypothetical protein TSUD_99220 [Trifolium subte... 74 2e-12 gb|PNY12642.1| pentatricopeptide repeat-containing protein chlor... 72 4e-12 dbj|GAU51039.1| hypothetical protein TSUD_99240 [Trifolium subte... 71 1e-11 ref|XP_013464321.1| PPR containing plant-like protein [Medicago ... 70 3e-11 ref|XP_013464320.1| PPR containing plant-like protein [Medicago ... 70 3e-11 gb|PNX93388.1| pentatricopeptide repeat-containing protein chlor... 70 4e-11 ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-11 gb|PNY14967.1| pentatricopeptide repeat-containing protein chlor... 67 2e-10 dbj|GAU44128.1| hypothetical protein TSUD_99160 [Trifolium subte... 67 2e-10 gb|KHN27740.1| Pentatricopeptide repeat-containing protein, chlo... 67 3e-10 ref|XP_019413997.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 ref|XP_020233432.1| pentatricopeptide repeat-containing protein ... 66 8e-10 gb|AFK33357.1| unknown [Medicago truncatula] 65 2e-09 ref|XP_007149272.1| hypothetical protein PHAVU_005G056300g [Phas... 65 2e-09 ref|XP_019443750.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-09 dbj|BAT93280.1| hypothetical protein VIGAN_07222200 [Vigna angul... 63 7e-09 ref|XP_014502486.1| pentatricopeptide repeat-containing protein ... 63 7e-09 ref|XP_017423818.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-09 >dbj|GAU44134.1| hypothetical protein TSUD_99220 [Trifolium subterraneum] Length = 492 Score = 73.6 bits (179), Expect = 2e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 GLAFEEEMD+AA+LLK+L KGVLSQSTVERLSMQYD KELTG Sbjct: 450 GLAFEEEMDLAANLLKDLCSKGVLSQSTVERLSMQYDLKELTG 492 >gb|PNY12642.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 410 Score = 72.4 bits (176), Expect = 4e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 GL FEEEMD+AA+LLKEL+ KGVLSQSTVERLSM YD KELTG Sbjct: 368 GLCFEEEMDLAANLLKELYSKGVLSQSTVERLSMLYDLKELTG 410 >dbj|GAU51039.1| hypothetical protein TSUD_99240 [Trifolium subterraneum] Length = 480 Score = 70.9 bits (172), Expect = 1e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 GLAFE+EMD+AA+LLKEL+ KGVLS STVERLSM YD KELTG Sbjct: 438 GLAFEDEMDLAANLLKELYSKGVLSHSTVERLSMLYDLKELTG 480 >ref|XP_013464321.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH38356.1| PPR containing plant-like protein [Medicago truncatula] Length = 448 Score = 70.1 bits (170), Expect = 3e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 406 LAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 LAFEEEM++AA LL EL++KGVLSQSTVERLSMQYD K+LTG Sbjct: 407 LAFEEEMELAATLLNELYLKGVLSQSTVERLSMQYDLKQLTG 448 >ref|XP_013464320.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH38355.1| PPR containing plant-like protein [Medicago truncatula] Length = 573 Score = 70.1 bits (170), Expect = 3e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 406 LAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 LAFEEEM++AA LL EL++KGVLSQSTVERLSMQYD K+LTG Sbjct: 532 LAFEEEMELAATLLNELYLKGVLSQSTVERLSMQYDLKQLTG 573 >gb|PNX93388.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 480 Score = 69.7 bits (169), Expect = 4e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 GL FEEE+D+AA+L+KEL+ KGVLSQSTVERLS+Q+D KELTG Sbjct: 438 GLCFEEEVDLAANLMKELYSKGVLSQSTVERLSIQFDLKELTG 480 >ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Cicer arietinum] Length = 572 Score = 69.3 bits (168), Expect = 5e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 G+AFEEE D+AA LLKEL +KGVLS++TVERLSMQYD KELTG Sbjct: 530 GIAFEEENDLAASLLKELCLKGVLSKNTVERLSMQYDLKELTG 572 >gb|PNY14967.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 480 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GL +EEEMD+AA+LLKEL++KGVLS+STVERL MQYD KEL Sbjct: 438 GLCYEEEMDLAANLLKELYLKGVLSESTVERLYMQYDLKEL 478 >dbj|GAU44128.1| hypothetical protein TSUD_99160 [Trifolium subterraneum] Length = 510 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 GL FEEE+D+AA+LLK L+ KGVLSQS ERLSMQYD KELTG Sbjct: 468 GLCFEEEIDLAANLLKGLYSKGVLSQSAAERLSMQYDLKELTG 510 >gb|KHN27740.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 450 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEEE D+AADL+KEL++K VLSQSTVERL MQYD KEL Sbjct: 406 GLAFEEETDIAADLMKELYLKKVLSQSTVERLCMQYDIKEL 446 >ref|XP_019413997.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Lupinus angustifolius] gb|OIV99035.1| hypothetical protein TanjilG_32294 [Lupinus angustifolius] Length = 571 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELT 284 GLA E+EMDMA DL+ EL+ K VLSQSTVERLS+QYDFKELT Sbjct: 529 GLASEDEMDMAVDLMNELYSKEVLSQSTVERLSLQYDFKELT 570 >ref|XP_006598186.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Glycine max] gb|KRH13661.1| hypothetical protein GLYMA_15G254900 [Glycine max] Length = 571 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEEE D+AADL+KEL++K VLSQSTVERL MQYD KEL Sbjct: 527 GLAFEEETDIAADLMKELYLKKVLSQSTVERLCMQYDIKEL 567 >ref|XP_003531505.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Glycine max] gb|KHN26812.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gb|KRH43794.1| hypothetical protein GLYMA_08G172400 [Glycine max] Length = 572 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEEE D+AADL+KEL++K VLSQSTVERL MQYD KEL Sbjct: 527 GLAFEEETDIAADLMKELYLKKVLSQSTVERLCMQYDIKEL 567 >ref|XP_020233432.1| pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Cajanus cajan] gb|KYP49109.1| hypothetical protein KK1_029139 [Cajanus cajan] Length = 571 Score = 65.9 bits (159), Expect = 8e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEEE D+A DLLKEL++K VLSQSTVERL MQYD KEL Sbjct: 527 GLAFEEETDIATDLLKELYVKEVLSQSTVERLCMQYDLKEL 567 >gb|AFK33357.1| unknown [Medicago truncatula] Length = 389 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 406 LAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKELTG 281 LAFEEEM++AA LL EL++KGVLSQSTVERL MQY K+LTG Sbjct: 348 LAFEEEMELAATLLNELYLKGVLSQSTVERLFMQYALKQLTG 389 >ref|XP_007149272.1| hypothetical protein PHAVU_005G056300g [Phaseolus vulgaris] gb|ESW21266.1| hypothetical protein PHAVU_005G056300g [Phaseolus vulgaris] Length = 571 Score = 64.7 bits (156), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEEE D+AADLLKEL K VLSQSTVERL MQ+DFKEL Sbjct: 527 GLAFEEETDIAADLLKELCGKEVLSQSTVERLCMQFDFKEL 567 >ref|XP_019443750.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Lupinus angustifolius] gb|OIW11658.1| hypothetical protein TanjilG_24352 [Lupinus angustifolius] Length = 574 Score = 63.9 bits (154), Expect = 4e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLA+E E DMAA+LLKEL++K VL QSTVERLSMQYD KEL Sbjct: 532 GLAYEGETDMAAELLKELYLKEVLCQSTVERLSMQYDLKEL 572 >dbj|BAT93280.1| hypothetical protein VIGAN_07222200 [Vigna angularis var. angularis] Length = 412 Score = 63.2 bits (152), Expect = 7e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEE+ D+AADLLKEL K VLSQSTVERL MQ+DFKEL Sbjct: 368 GLAFEEKTDIAADLLKELCGKEVLSQSTVERLCMQFDFKEL 408 >ref|XP_014502486.1| pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vigna radiata var. radiata] Length = 571 Score = 63.2 bits (152), Expect = 7e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEE+ D+AADLLKEL K VLSQSTVERL MQ+DFKEL Sbjct: 527 GLAFEEKTDIAADLLKELCGKEVLSQSTVERLCMQFDFKEL 567 >ref|XP_017423818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vigna angularis] gb|KOM42599.1| hypothetical protein LR48_Vigan05g020300 [Vigna angularis] Length = 571 Score = 63.2 bits (152), Expect = 7e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 409 GLAFEEEMDMAADLLKELHMKGVLSQSTVERLSMQYDFKEL 287 GLAFEE+ D+AADLLKEL K VLSQSTVERL MQ+DFKEL Sbjct: 527 GLAFEEKTDIAADLLKELCGKEVLSQSTVERLCMQFDFKEL 567