BLASTX nr result
ID: Astragalus24_contig00013350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00013350 (907 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN32124.1| Hypothetical protein glysoja_028919 [Glycine soja] 102 6e-21 gb|KHN21954.1| Hypothetical protein glysoja_008866 [Glycine soja] 102 1e-20 gb|KYP68184.1| putative protein phosphatase 2C 4 [Cajanus cajan] 102 2e-20 ref|XP_020215057.1| probable protein phosphatase 2C 4 [Cajanus c... 102 2e-20 ref|XP_006590985.1| PREDICTED: probable protein phosphatase 2C 4... 102 2e-20 ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4... 102 2e-20 gb|PNX93021.1| putative protein phosphatase 2C 4-like protein [T... 101 2e-20 ref|XP_013456126.1| protein phosphatase 2C family protein [Medic... 101 3e-20 ref|XP_004505865.1| PREDICTED: probable protein phosphatase 2C 4... 100 1e-19 ref|XP_014494434.1| probable protein phosphatase 2C 4 [Vigna rad... 99 2e-19 ref|XP_007132067.1| hypothetical protein PHAVU_011G064200g [Phas... 99 2e-19 ref|XP_017406224.1| PREDICTED: probable protein phosphatase 2C 4... 99 2e-19 dbj|BAT90721.1| hypothetical protein VIGAN_06200200 [Vigna angul... 99 2e-19 ref|XP_016187289.1| probable protein phosphatase 2C 4 [Arachis i... 98 4e-19 ref|XP_015952257.1| probable protein phosphatase 2C 4 [Arachis d... 97 8e-19 ref|XP_019454063.1| PREDICTED: probable protein phosphatase 2C 2... 97 1e-18 ref|XP_019448630.1| PREDICTED: probable protein phosphatase 2C 4... 96 4e-18 ref|XP_019413967.1| PREDICTED: probable protein phosphatase 2C 4... 94 9e-18 gb|PPR85438.1| hypothetical protein GOBAR_AA35248 [Gossypium bar... 89 5e-17 ref|XP_002313436.1| hypothetical protein POPTR_0009s03590g [Popu... 89 6e-16 >gb|KHN32124.1| Hypothetical protein glysoja_028919 [Glycine soja] Length = 384 Score = 102 bits (253), Expect = 6e-21 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 276 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 325 >gb|KHN21954.1| Hypothetical protein glysoja_008866 [Glycine soja] Length = 482 Score = 102 bits (253), Expect = 1e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 374 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 423 >gb|KYP68184.1| putative protein phosphatase 2C 4 [Cajanus cajan] Length = 663 Score = 102 bits (253), Expect = 2e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 555 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 604 >ref|XP_020215057.1| probable protein phosphatase 2C 4 [Cajanus cajan] Length = 706 Score = 102 bits (253), Expect = 2e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 598 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 647 >ref|XP_006590985.1| PREDICTED: probable protein phosphatase 2C 4 [Glycine max] gb|KRH29800.1| hypothetical protein GLYMA_11G139500 [Glycine max] Length = 720 Score = 102 bits (253), Expect = 2e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 612 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 661 >ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4 [Glycine max] gb|KRH24796.1| hypothetical protein GLYMA_12G063100 [Glycine max] Length = 720 Score = 102 bits (253), Expect = 2e-20 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 612 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 661 >gb|PNX93021.1| putative protein phosphatase 2C 4-like protein [Trifolium pratense] Length = 558 Score = 101 bits (252), Expect = 2e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYITC PYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 450 NSPYITCQPYLKHHRLGQKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 499 >ref|XP_013456126.1| protein phosphatase 2C family protein [Medicago truncatula] gb|KEH30157.1| protein phosphatase 2C family protein [Medicago truncatula] Length = 704 Score = 101 bits (252), Expect = 3e-20 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYITC PYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 596 NSPYITCQPYLKHHRLGQKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 645 >ref|XP_004505865.1| PREDICTED: probable protein phosphatase 2C 4 [Cicer arietinum] Length = 724 Score = 100 bits (248), Expect = 1e-19 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+C PYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 616 NSPYISCQPYLKHHRLGQKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 665 >ref|XP_014494434.1| probable protein phosphatase 2C 4 [Vigna radiata var. radiata] Length = 712 Score = 99.4 bits (246), Expect = 2e-19 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVE FITLQ Sbjct: 604 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVEHFITLQ 653 >ref|XP_007132067.1| hypothetical protein PHAVU_011G064200g [Phaseolus vulgaris] gb|ESW04061.1| hypothetical protein PHAVU_011G064200g [Phaseolus vulgaris] Length = 712 Score = 99.4 bits (246), Expect = 2e-19 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVE FITLQ Sbjct: 604 NSPYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVEHFITLQ 653 >ref|XP_017406224.1| PREDICTED: probable protein phosphatase 2C 4 [Vigna angularis] Length = 709 Score = 99.0 bits (245), Expect = 2e-19 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVE FITLQ Sbjct: 601 NSPYINCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVEHFITLQ 650 >dbj|BAT90721.1| hypothetical protein VIGAN_06200200 [Vigna angularis var. angularis] Length = 739 Score = 99.0 bits (245), Expect = 2e-19 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYI CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVE FITLQ Sbjct: 601 NSPYINCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVEHFITLQ 650 >ref|XP_016187289.1| probable protein phosphatase 2C 4 [Arachis ipaensis] Length = 740 Score = 98.2 bits (243), Expect = 4e-19 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +3 Query: 54 PYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 PYI+CLPYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 634 PYISCLPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 681 >ref|XP_015952257.1| probable protein phosphatase 2C 4 [Arachis duranensis] Length = 714 Score = 97.4 bits (241), Expect = 8e-19 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +3 Query: 54 PYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 PYI+C+PYLKHHRLG KDKFLILCSDGLYQYLSNEEAVAEVELFITLQ Sbjct: 608 PYISCMPYLKHHRLGPKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 655 >ref|XP_019454063.1| PREDICTED: probable protein phosphatase 2C 23 [Lupinus angustifolius] gb|OIW05755.1| hypothetical protein TanjilG_23541 [Lupinus angustifolius] Length = 708 Score = 96.7 bits (239), Expect = 1e-18 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +3 Query: 51 SPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 SPYI+C PYLKHHRLG KDKFLILCSDGLYQY+SNEEAVAEVELFITLQ Sbjct: 601 SPYISCQPYLKHHRLGPKDKFLILCSDGLYQYMSNEEAVAEVELFITLQ 649 >ref|XP_019448630.1| PREDICTED: probable protein phosphatase 2C 4 [Lupinus angustifolius] gb|OIW08627.1| hypothetical protein TanjilG_03303 [Lupinus angustifolius] Length = 702 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 51 SPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 SPYI+C PYLKHHRLG KDKFLILCSDGLYQY+SNE+AVAEVELFITLQ Sbjct: 595 SPYISCQPYLKHHRLGPKDKFLILCSDGLYQYMSNEQAVAEVELFITLQ 643 >ref|XP_019413967.1| PREDICTED: probable protein phosphatase 2C 4 [Lupinus angustifolius] Length = 700 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 51 SPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 SPYI+C PYLKHHR+G KDKFLILCSDGLYQY+SNE+AVAEVELFITLQ Sbjct: 593 SPYISCQPYLKHHRVGPKDKFLILCSDGLYQYMSNEQAVAEVELFITLQ 641 >gb|PPR85438.1| hypothetical protein GOBAR_AA35248 [Gossypium barbadense] Length = 256 Score = 89.0 bits (219), Expect = 5e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYITC+P L HHRLG KD+FL+L SDGLYQYL+NEEAV+EVELFITLQ Sbjct: 148 NSPYITCVPSLHHHRLGPKDRFLVLSSDGLYQYLTNEEAVSEVELFITLQ 197 >ref|XP_002313436.1| hypothetical protein POPTR_0009s03590g [Populus trichocarpa] gb|PNT19290.1| hypothetical protein POPTR_009G030600v3 [Populus trichocarpa] Length = 670 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = +3 Query: 48 NSPYITCLPYLKHHRLGLKDKFLILCSDGLYQYLSNEEAVAEVELFITLQ 197 NSPYITCLP L HHRLG KD+FLIL SDGLYQYL+NEEAV EVELFITLQ Sbjct: 562 NSPYITCLPSLYHHRLGPKDRFLILSSDGLYQYLTNEEAVYEVELFITLQ 611