BLASTX nr result
ID: Astragalus24_contig00012232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00012232 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612169.2| F-box protein interaction domain protein [Me... 73 3e-12 ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cic... 72 8e-12 gb|PNX81323.1| F-box protein [Trifolium pratense] 67 2e-11 ref|XP_013449582.1| F-box protein interaction domain protein [Me... 69 6e-11 ref|XP_003610871.2| F-box protein interaction domain protein [Me... 68 1e-10 ref|XP_013453553.1| F-box protein interaction domain protein [Me... 68 1e-10 dbj|GAU24035.1| hypothetical protein TSUD_328390 [Trifolium subt... 67 2e-10 ref|XP_013453551.1| F-box protein interaction domain protein [Me... 67 2e-10 gb|PNY09680.1| F-box family protein [Trifolium pratense] 67 4e-10 ref|XP_003612244.2| F-box protein interaction domain protein [Me... 66 6e-10 ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06... 66 8e-10 gb|PNX88716.1| F-box family protein [Trifolium pratense] 64 2e-09 gb|AFK37781.1| unknown [Lotus japonicus] 63 7e-09 ref|XP_003612151.2| F-box protein interaction domain protein [Me... 62 2e-08 gb|AFK40065.1| unknown [Medicago truncatula] 62 2e-08 dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subt... 61 3e-08 ref|XP_003612153.1| F-box protein interaction domain protein [Me... 60 6e-08 ref|XP_013455133.1| F-box protein interaction domain protein [Me... 59 2e-07 ref|XP_003612650.1| F-box protein interaction domain protein [Me... 57 1e-06 ref|XP_003612646.2| F-box protein interaction domain protein [Me... 57 1e-06 >ref|XP_003612169.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95127.2| F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 72.8 bits (177), Expect = 3e-12 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 E+IPH+PSLISLKD+VKGDNI+VLN+HS+CAN++LPE+ E L L+ Sbjct: 442 EIIPHVPSLISLKDVVKGDNIEVLNIHSRCANVELPEENEVLSLS 486 >ref|XP_004512128.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_004512171.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574463.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] ref|XP_012574465.1| PREDICTED: F-box protein At3g07870-like [Cicer arietinum] Length = 488 Score = 71.6 bits (174), Expect = 8e-12 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLALAF 144 EVIPHIPSLISLKD+VKGDNI+VLN+HS+C KLPE+ E L L F Sbjct: 431 EVIPHIPSLISLKDVVKGDNIEVLNIHSRCTKFKLPEENEVLSLVQEF 478 >gb|PNX81323.1| F-box protein [Trifolium pratense] Length = 131 Score = 67.0 bits (162), Expect = 2e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = +1 Query: 4 VIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 VIPHIPSLISLKD+VKGDNI+VL++HS+CA KL ++ E L+LA Sbjct: 75 VIPHIPSLISLKDVVKGDNIEVLSIHSRCAKFKLQKENEVLFLA 118 >ref|XP_013449582.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH23610.1| F-box protein interaction domain protein [Medicago truncatula] Length = 305 Score = 68.6 bits (166), Expect = 6e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLALAF 144 EVIPHIPSLISLKD+VKGDNI+V ++HS+CA KL E+ E L+LA F Sbjct: 257 EVIPHIPSLISLKDVVKGDNIEVFSIHSRCAKYKLWEESEVLFLAQEF 304 >ref|XP_003610871.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES93829.2| F-box protein interaction domain protein [Medicago truncatula] Length = 448 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 E+IPHIPSLISLKD++KGDNI+VLN+HS+CA KL E+ E L L+ Sbjct: 400 EIIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREETEGLSLS 444 >ref|XP_013453553.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27586.1| F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 68.2 bits (165), Expect = 1e-10 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 E+IPH+PSLISLKD+VKGDN ++LN+HS+CAN+KL E+ E L L+ Sbjct: 411 EIIPHVPSLISLKDVVKGDNTEMLNIHSRCANVKLEEENEVLSLS 455 >dbj|GAU24035.1| hypothetical protein TSUD_328390 [Trifolium subterraneum] Length = 341 Score = 67.4 bits (163), Expect = 2e-10 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 4 VIPHIPSLISLKDLVKG-DNIKVLNVHSQCANLKLPEDYEDLYLALAF 144 VIPHIPSLISLKD+VKG DN +VL++HS+CA KLPED E L+LA F Sbjct: 283 VIPHIPSLISLKDIVKGGDNNEVLSIHSRCAKYKLPEDNEVLFLAQVF 330 >ref|XP_013453551.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH27584.1| F-box protein interaction domain protein [Medicago truncatula] Length = 496 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYL 132 EVIPHIPSLISLKD++KGDNI+VLN+HS+CA KL E+ E L L Sbjct: 445 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREEKEVLSL 488 >gb|PNY09680.1| F-box family protein [Trifolium pratense] Length = 478 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 E+IPHIPSLISLKD++KGDNI+V N+HS+CA KL E+ E L L+ Sbjct: 372 EIIPHIPSLISLKDVIKGDNIEVQNIHSRCAKFKLREENETLSLS 416 >ref|XP_003612244.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95202.2| F-box protein interaction domain protein [Medicago truncatula] Length = 482 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYL 132 EVIPHIPSLISLKD++KGDNI+VLN+HS+CA KL E+ + L L Sbjct: 434 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCAKFKLREERDVLSL 477 >ref|XP_019454515.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X1 [Lupinus angustifolius] Length = 468 Score = 65.9 bits (159), Expect = 8e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 EV PHIPSLISLKD VKG+N++VLNVH +CA KL E+ E L+LA Sbjct: 424 EVFPHIPSLISLKDAVKGNNVEVLNVHLRCAKFKLREENEALFLA 468 >gb|PNX88716.1| F-box family protein [Trifolium pratense] Length = 272 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYE 120 EVI HIPSLISLKD+VKGDNI+VLN+HS+CA KL E+ E Sbjct: 213 EVISHIPSLISLKDVVKGDNIEVLNIHSRCAKFKLREENE 252 >gb|AFK37781.1| unknown [Lotus japonicus] Length = 489 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 +VIPHIPS ISLKD+VKGDNI+VLNVHS+ K E+ DL+LA Sbjct: 427 DVIPHIPSFISLKDVVKGDNIEVLNVHSRYEEFKFMEENADLFLA 471 >ref|XP_003612151.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95109.2| F-box protein interaction domain protein [Medicago truncatula] Length = 512 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLAL 138 EVIPHIPSLISLKD++KG NI+VLN+HS+CA KL + E L +L Sbjct: 431 EVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESLAKSL 476 >gb|AFK40065.1| unknown [Medicago truncatula] Length = 479 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLA 135 EVIPHIPSLISLKD++KG NI+VLN+HS+CA KL + E L L+ Sbjct: 431 EVIPHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKEVLSLS 475 >dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subterraneum] Length = 357 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPED 114 EVIPHIPSLISLKD V+ DN+ VLNV+S+CA KLPE+ Sbjct: 320 EVIPHIPSLISLKDAVRRDNVDVLNVNSRCAKFKLPEE 357 >ref|XP_003612153.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES95111.1| F-box protein interaction domain protein [Medicago truncatula] Length = 507 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 2/44 (4%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCA--NLKLPEDYEDL 126 EVIPHIPSLISLKD++KGDNI+VLN+HS+C L E+ EDL Sbjct: 445 EVIPHIPSLISLKDVLKGDNIEVLNIHSRCVFKFFNLHEENEDL 488 >ref|XP_013455133.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH29181.1| F-box protein interaction domain protein [Medicago truncatula] Length = 520 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDLYLAL 138 EVI HIPSLISLKD++KG NI+VLN+HS+CA KL + E L +L Sbjct: 431 EVIQHIPSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESLVKSL 476 >ref|XP_003612650.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES95608.1| F-box protein interaction domain protein [Medicago truncatula] Length = 441 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDL 126 E+ PH P LISLKD+VKG NI+V NV+S+CA +++PE+ E L Sbjct: 394 ELFPHSPGLISLKDVVKGGNIEVQNVYSRCAKVRVPEENESL 435 >ref|XP_003612646.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES95604.2| F-box protein interaction domain protein [Medicago truncatula] Length = 452 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 1 EVIPHIPSLISLKDLVKGDNIKVLNVHSQCANLKLPEDYEDL 126 E+ PH P LISLKD+VKG NI+V NV+S+CA +++PE+ E L Sbjct: 405 ELFPHSPGLISLKDVVKGGNIEVQNVYSRCAKVRVPEENESL 446