BLASTX nr result
ID: Astragalus24_contig00009549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00009549 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019423564.1| PREDICTED: armadillo repeat-containing prote... 72 5e-13 gb|PNY05907.1| armadillo repeat-containing protein 7-like, parti... 72 6e-13 gb|PNX73399.1| armadillo repeat-containing protein 7-like [Trifo... 72 8e-13 dbj|GAU36768.1| hypothetical protein TSUD_213350 [Trifolium subt... 72 2e-12 ref|XP_004504996.1| PREDICTED: armadillo repeat-containing prote... 70 3e-12 ref|XP_012568504.1| PREDICTED: armadillo repeat-containing prote... 70 3e-12 ref|XP_022879721.1| armadillo repeat-containing protein 7-like i... 69 1e-11 ref|XP_022879720.1| armadillo repeat-containing protein 7-like i... 69 1e-11 gb|PIN04869.1| putative ARM repeat protein [Handroanthus impetig... 69 1e-11 ref|XP_020971740.1| armadillo repeat-containing protein 7-like i... 67 4e-11 ref|XP_016183736.1| armadillo repeat-containing protein 7-like i... 67 4e-11 gb|PNT56060.1| hypothetical protein POPTR_001G225300v3 [Populus ... 67 4e-11 ref|XP_012858980.1| PREDICTED: armadillo repeat-containing prote... 67 4e-11 ref|XP_011035031.1| PREDICTED: armadillo repeat-containing prote... 67 4e-11 ref|XP_002298151.1| armadillo/beta-catenin repeat family protein... 67 4e-11 ref|XP_015577319.1| PREDICTED: armadillo repeat-containing prote... 66 6e-11 ref|XP_015577318.1| PREDICTED: armadillo repeat-containing prote... 66 7e-11 ref|NP_001331399.1| ARM repeat superfamily protein [Arabidopsis ... 65 7e-11 gb|EEF39139.1| Armadillo repeat-containing protein, putative [Ri... 66 8e-11 gb|PHU20101.1| hypothetical protein BC332_11252 [Capsicum chinense] 66 9e-11 >ref|XP_019423564.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] ref|XP_019423565.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] ref|XP_019423566.1| PREDICTED: armadillo repeat-containing protein 7 [Lupinus angustifolius] gb|OIV93711.1| hypothetical protein TanjilG_16562 [Lupinus angustifolius] Length = 177 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTNDQRQQERTGKYGTPRLQYLQELV+QFQN ++D Sbjct: 1 MFTNDQRQQERTGKYGTPRLQYLQELVIQFQNTNDD 36 >gb|PNY05907.1| armadillo repeat-containing protein 7-like, partial [Trifolium pratense] Length = 162 Score = 71.6 bits (174), Expect = 6e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQQERTG+YGTPRLQYLQELV QFQNASED Sbjct: 1 MFTNNQRQQERTGRYGTPRLQYLQELVTQFQNASED 36 >gb|PNX73399.1| armadillo repeat-containing protein 7-like [Trifolium pratense] Length = 177 Score = 71.6 bits (174), Expect = 8e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQQERTG+YGTPRLQYLQELV QFQNASED Sbjct: 1 MFTNNQRQQERTGRYGTPRLQYLQELVTQFQNASED 36 >dbj|GAU36768.1| hypothetical protein TSUD_213350 [Trifolium subterraneum] Length = 267 Score = 72.4 bits (176), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 293 ASMFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 A MFTN+QRQQERTG+YGTPRLQYLQELV QFQNASED Sbjct: 89 AYMFTNNQRQQERTGRYGTPRLQYLQELVTQFQNASED 126 >ref|XP_004504996.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] ref|XP_004504997.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] ref|XP_012572496.1| PREDICTED: armadillo repeat-containing protein 7-like [Cicer arietinum] Length = 177 Score = 70.1 bits (170), Expect = 3e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTNDQRQQERTG+YGTPRLQYLQELV QFQ ASED Sbjct: 1 MFTNDQRQQERTGRYGTPRLQYLQELVTQFQIASED 36 >ref|XP_012568504.1| PREDICTED: armadillo repeat-containing protein 7 [Cicer arietinum] Length = 177 Score = 70.1 bits (170), Expect = 3e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTNDQRQQERTG+YGTPRLQYLQELV QFQ ASED Sbjct: 1 MFTNDQRQQERTGRYGTPRLQYLQELVTQFQIASED 36 >ref|XP_022879721.1| armadillo repeat-containing protein 7-like isoform X2 [Olea europaea var. sylvestris] Length = 208 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +2 Query: 290 AASMFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 AA+MFTN++RQ+ERTGKYGTPR+QYLQELV QFQNAS + Sbjct: 28 AANMFTNERRQEERTGKYGTPRMQYLQELVSQFQNASNE 66 >ref|XP_022879720.1| armadillo repeat-containing protein 7-like isoform X1 [Olea europaea var. sylvestris] Length = 209 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +2 Query: 290 AASMFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 AA+MFTN++RQ+ERTGKYGTPR+QYLQELV QFQNAS + Sbjct: 28 AANMFTNERRQEERTGKYGTPRMQYLQELVSQFQNASNE 66 >gb|PIN04869.1| putative ARM repeat protein [Handroanthus impetiginosus] gb|PIN07345.1| putative ARM repeat protein [Handroanthus impetiginosus] Length = 175 Score = 68.6 bits (166), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTNDQRQ+ERTGKYGTPRLQYLQELV QFQN+S + Sbjct: 1 MFTNDQRQKERTGKYGTPRLQYLQELVAQFQNSSSE 36 >ref|XP_020971740.1| armadillo repeat-containing protein 7-like isoform X2 [Arachis ipaensis] Length = 186 Score = 67.4 bits (163), Expect = 4e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 296 SMFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 SMFTNDQRQQERTGKYG+PR QYLQELV QFQN +++ Sbjct: 9 SMFTNDQRQQERTGKYGSPRFQYLQELVSQFQNTTDE 45 >ref|XP_016183736.1| armadillo repeat-containing protein 7-like isoform X1 [Arachis ipaensis] Length = 186 Score = 67.4 bits (163), Expect = 4e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 296 SMFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 SMFTNDQRQQERTGKYG+PR QYLQELV QFQN +++ Sbjct: 9 SMFTNDQRQQERTGKYGSPRFQYLQELVSQFQNTTDE 45 >gb|PNT56060.1| hypothetical protein POPTR_001G225300v3 [Populus trichocarpa] Length = 170 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ERTGKYGTPRLQYLQELV QFQNA+++ Sbjct: 1 MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADE 36 >ref|XP_012858980.1| PREDICTED: armadillo repeat-containing protein 7 [Erythranthe guttata] gb|EYU19460.1| hypothetical protein MIMGU_mgv1a021502mg [Erythranthe guttata] Length = 176 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTND+RQ+ERTGKYG+PRLQYLQELV QFQNAS + Sbjct: 1 MFTNDERQKERTGKYGSPRLQYLQELVAQFQNASNE 36 >ref|XP_011035031.1| PREDICTED: armadillo repeat-containing protein 7 [Populus euphratica] Length = 178 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ERTGKYGTPRLQYLQELV QFQNA+++ Sbjct: 1 MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADE 36 >ref|XP_002298151.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gb|PNT56059.1| hypothetical protein POPTR_001G225300v3 [Populus trichocarpa] Length = 178 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ERTGKYGTPRLQYLQELV QFQNA+++ Sbjct: 1 MFTNNQRQEERTGKYGTPRLQYLQELVNQFQNAADE 36 >ref|XP_015577319.1| PREDICTED: armadillo repeat-containing protein 7 isoform X3 [Ricinus communis] Length = 161 Score = 66.2 bits (160), Expect = 6e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ER GKYGTPRLQYLQELV QFQNAS++ Sbjct: 1 MFTNNQRQEERIGKYGTPRLQYLQELVSQFQNASDE 36 >ref|XP_015577318.1| PREDICTED: armadillo repeat-containing protein 7 isoform X2 [Ricinus communis] Length = 162 Score = 66.2 bits (160), Expect = 7e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ER GKYGTPRLQYLQELV QFQNAS++ Sbjct: 1 MFTNNQRQEERIGKYGTPRLQYLQELVSQFQNASDE 36 >ref|NP_001331399.1| ARM repeat superfamily protein [Arabidopsis thaliana] gb|ANM69743.1| ARM repeat superfamily protein [Arabidopsis thaliana] Length = 131 Score = 65.5 bits (158), Expect = 7e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ERTGK+GTPRLQYLQELV QFQNA+++ Sbjct: 1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDE 36 >gb|EEF39139.1| Armadillo repeat-containing protein, putative [Ricinus communis] Length = 172 Score = 66.2 bits (160), Expect = 8e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN+QRQ+ER GKYGTPRLQYLQELV QFQNAS++ Sbjct: 1 MFTNNQRQEERIGKYGTPRLQYLQELVSQFQNASDE 36 >gb|PHU20101.1| hypothetical protein BC332_11252 [Capsicum chinense] Length = 178 Score = 66.2 bits (160), Expect = 9e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 299 MFTNDQRQQERTGKYGTPRLQYLQELVLQFQNASED 406 MFTN QRQ+ERTGKYGTPR+QYLQELV QFQNAS + Sbjct: 1 MFTNSQRQEERTGKYGTPRVQYLQELVTQFQNASAE 36