BLASTX nr result
ID: Astragalus24_contig00009221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00009221 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526784.1| PREDICTED: quinone oxidoreductase-like prote... 67 4e-10 gb|AFK46230.1| unknown [Lotus japonicus] 65 1e-09 gb|PNX93377.1| quinone oxidoreductase-like protein 2 [Trifolium ... 64 1e-09 ref|XP_013461475.1| zinc-binding dehydrogenase family oxidoreduc... 65 1e-09 ref|XP_004502804.1| PREDICTED: quinone oxidoreductase-like prote... 65 1e-09 ref|XP_003523296.1| PREDICTED: quinone oxidoreductase-like prote... 64 3e-09 ref|XP_016181510.1| quinone oxidoreductase-like protein 2 homolo... 64 4e-09 ref|XP_015945004.1| quinone oxidoreductase-like protein 2 homolo... 64 4e-09 dbj|GAU42586.1| hypothetical protein TSUD_303020 [Trifolium subt... 63 9e-09 ref|XP_020229123.1| quinone oxidoreductase-like protein 2 homolo... 63 9e-09 ref|XP_019417509.1| PREDICTED: quinone oxidoreductase-like prote... 62 2e-08 ref|XP_017421662.1| PREDICTED: quinone oxidoreductase-like prote... 61 3e-08 ref|XP_014522611.1| quinone oxidoreductase-like protein 2 homolo... 61 3e-08 gb|KOM41003.1| hypothetical protein LR48_Vigan04g120100 [Vigna a... 61 4e-08 ref|XP_007136397.1| hypothetical protein PHAVU_009G041600g [Phas... 60 6e-08 ref|XP_006842596.1| quinone oxidoreductase-like protein 2 homolo... 57 1e-06 ref|XP_017619032.1| PREDICTED: quinone oxidoreductase-like prote... 56 3e-06 emb|CDP13874.1| unnamed protein product [Coffea canephora] 54 9e-06 >ref|XP_003526784.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Glycine max] gb|KRH53690.1| hypothetical protein GLYMA_06G140300 [Glycine max] Length = 347 Score = 66.6 bits (161), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYPLSEANLAFSAIK+RK IGKVMIVFDEK TRS L Sbjct: 311 HSYPLSEANLAFSAIKDRKVIGKVMIVFDEKPTRSKL 347 >gb|AFK46230.1| unknown [Lotus japonicus] Length = 346 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYPLSEANLAF AIK+RK IGKVMIVFDEK TRS L Sbjct: 310 HSYPLSEANLAFGAIKDRKVIGKVMIVFDEKSTRSKL 346 >gb|PNX93377.1| quinone oxidoreductase-like protein 2 [Trifolium pratense] Length = 229 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAFSAI++RKAIGKVMIVFDEK TRS L Sbjct: 193 HSYSLSEANLAFSAIRDRKAIGKVMIVFDEKSTRSKL 229 >ref|XP_013461475.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula] gb|KEH35510.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula] Length = 346 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAF+AI++RKAIGKVMIVFDEKITRS L Sbjct: 310 HSYGLSEANLAFTAIRDRKAIGKVMIVFDEKITRSKL 346 >ref|XP_004502804.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Cicer arietinum] Length = 346 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAFSAI++RKAIGKVMIVFD+K+TRS L Sbjct: 310 HSYSLSEANLAFSAIRDRKAIGKVMIVFDDKVTRSKL 346 >ref|XP_003523296.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Glycine max] gb|KRH64241.1| hypothetical protein GLYMA_04G224400 [Glycine max] Length = 346 Score = 64.3 bits (155), Expect = 3e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYPLSEA LAFSAIK+RK IGKVMIVFDEK TRS L Sbjct: 310 HSYPLSEAYLAFSAIKDRKVIGKVMIVFDEKTTRSKL 346 >ref|XP_016181510.1| quinone oxidoreductase-like protein 2 homolog [Arachis ipaensis] Length = 346 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAFSAIK+RK IGKVMIVFD+K+TRS L Sbjct: 310 HSYRLSEANLAFSAIKDRKVIGKVMIVFDDKLTRSKL 346 >ref|XP_015945004.1| quinone oxidoreductase-like protein 2 homolog [Arachis duranensis] Length = 346 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAFSAIK+RK IGKVMIVFD+K+TRS L Sbjct: 310 HSYRLSEANLAFSAIKDRKVIGKVMIVFDDKLTRSKL 346 >dbj|GAU42586.1| hypothetical protein TSUD_303020 [Trifolium subterraneum] Length = 327 Score = 62.8 bits (151), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY L+EANLAFSAIK+RK IGKVMIVFDEK TRS L Sbjct: 291 HSYSLAEANLAFSAIKDRKVIGKVMIVFDEKSTRSKL 327 >ref|XP_020229123.1| quinone oxidoreductase-like protein 2 homolog [Cajanus cajan] gb|KYP53778.1| Quinone oxidoreductase-like protein 2 isogeny [Cajanus cajan] Length = 346 Score = 62.8 bits (151), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSY LSEANLAFSAIK+RK IGKVMIVFDEK+ RS L Sbjct: 310 HSYRLSEANLAFSAIKDRKVIGKVMIVFDEKLPRSKL 346 >ref|XP_019417509.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Lupinus angustifolius] gb|OIV96889.1| hypothetical protein TanjilG_00471 [Lupinus angustifolius] Length = 346 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 H+Y LSEANLAF+AI++RKAIGKVMIVFDEK TRS L Sbjct: 310 HTYRLSEANLAFTAIRDRKAIGKVMIVFDEKSTRSKL 346 >ref|XP_017421662.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Vigna angularis] dbj|BAT78973.1| hypothetical protein VIGAN_02174600 [Vigna angularis var. angularis] Length = 346 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYP SEAN AFSA+K+RK IGKVMIVFDEK TRS L Sbjct: 310 HSYPPSEANFAFSAMKDRKVIGKVMIVFDEKHTRSKL 346 >ref|XP_014522611.1| quinone oxidoreductase-like protein 2 homolog [Vigna radiata var. radiata] ref|XP_022632146.1| quinone oxidoreductase-like protein 2 homolog [Vigna radiata var. radiata] ref|XP_022632147.1| quinone oxidoreductase-like protein 2 homolog [Vigna radiata var. radiata] Length = 346 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYP SEAN AFSA+K+RK IGKVMIVFDEK TRS L Sbjct: 310 HSYPPSEANFAFSAMKDRKVIGKVMIVFDEKHTRSKL 346 >gb|KOM41003.1| hypothetical protein LR48_Vigan04g120100 [Vigna angularis] Length = 456 Score = 61.2 bits (147), Expect = 4e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYP SEAN AFSA+K+RK IGKVMIVFDEK TRS L Sbjct: 420 HSYPPSEANFAFSAMKDRKVIGKVMIVFDEKHTRSKL 456 >ref|XP_007136397.1| hypothetical protein PHAVU_009G041600g [Phaseolus vulgaris] gb|ESW08391.1| hypothetical protein PHAVU_009G041600g [Phaseolus vulgaris] Length = 346 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKITRSNL 311 HSYP SE NLAFSAIK+RK IGKVM+VFDEK +RS L Sbjct: 310 HSYPPSEVNLAFSAIKDRKVIGKVMVVFDEKHSRSKL 346 >ref|XP_006842596.1| quinone oxidoreductase-like protein 2 homolog [Amborella trichopoda] gb|ERN04271.1| hypothetical protein AMTR_s00077p00167100 [Amborella trichopoda] Length = 346 Score = 57.0 bits (136), Expect = 1e-06 Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVF-DEKITRSNL 311 HSY LSEANLAFSAIKERKAIGKVMI F D + TRS L Sbjct: 309 HSYTLSEANLAFSAIKERKAIGKVMITFGDNRETRSRL 346 >ref|XP_017619032.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog [Gossypium arboreum] Length = 344 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEK 329 H+Y LSEANLAFSAIK+RKA+GKVMIVFD+K Sbjct: 307 HTYSLSEANLAFSAIKDRKAMGKVMIVFDDK 337 >emb|CDP13874.1| unnamed protein product [Coffea canephora] Length = 348 Score = 54.3 bits (129), Expect = 9e-06 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -1 Query: 421 HSYPLSEANLAFSAIKERKAIGKVMIVFDEKIT-RSNL 311 H++ LSEANLAFSA+K+RKAIGKVMIVFD++ T RS L Sbjct: 311 HAFSLSEANLAFSALKDRKAIGKVMIVFDDQKTFRSKL 348