BLASTX nr result
ID: Astragalus24_contig00008427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00008427 (655 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN31947.1| hypothetical protein glysoja_025781 [Glycine soja... 54 2e-06 ref|XP_007132650.1| hypothetical protein PHAVU_011G113100g [Phas... 53 3e-06 >gb|KHN31947.1| hypothetical protein glysoja_025781 [Glycine soja] gb|KHN41143.1| hypothetical protein glysoja_017187 [Glycine soja] gb|KRH56016.1| hypothetical protein GLYMA_06G296400 [Glycine max] Length = 51 Score = 53.5 bits (127), Expect = 2e-06 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = +3 Query: 72 MAKLEEMDESVSKTKKKGNHGSTRLFVIVDYXXXXXXXXXXXXXXXKVVG 221 MAKLEE+D SVSKTKKK NHGST FV VDY K+VG Sbjct: 1 MAKLEEIDNSVSKTKKKRNHGSTGFFVFVDYLYLLIFLGFLCFIIFKIVG 50 >ref|XP_007132650.1| hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] gb|ESW04644.1| hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] Length = 51 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 72 MAKLEEMDESVSKTKKKGNHGSTRLFVIVDY 164 MAKLEEMD SV+K KKK NHGSTR FV VDY Sbjct: 1 MAKLEEMDNSVAKIKKKRNHGSTRFFVFVDY 31