BLASTX nr result
ID: Astragalus24_contig00008304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00008304 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013470154.1| transmembrane protein, putative [Medicago tr... 60 2e-08 >ref|XP_013470154.1| transmembrane protein, putative [Medicago truncatula] gb|KEH44192.1| transmembrane protein, putative [Medicago truncatula] Length = 87 Score = 59.7 bits (143), Expect = 2e-08 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = -3 Query: 408 MVRQWRHYQGDXXXXXXXSVEELASLVFMLSAVLLTLSLFAATIFFCADGV 256 M RQW+ VEE+ASLVFML AVL+TLSLFAA IFFCADGV Sbjct: 1 MGRQWKEIGLTRHHVGGSLVEEIASLVFMLCAVLVTLSLFAAIIFFCADGV 51