BLASTX nr result
ID: Astragalus24_contig00008292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00008292 (709 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX93021.1| putative protein phosphatase 2C 4-like protein [T... 87 6e-16 ref|XP_013456126.1| protein phosphatase 2C family protein [Medic... 87 6e-16 ref|XP_004505865.1| PREDICTED: probable protein phosphatase 2C 4... 87 6e-16 dbj|GAU47240.1| hypothetical protein TSUD_87540 [Trifolium subte... 86 2e-15 ref|XP_019448630.1| PREDICTED: probable protein phosphatase 2C 4... 84 1e-14 ref|XP_019454063.1| PREDICTED: probable protein phosphatase 2C 2... 80 2e-13 ref|XP_020214467.1| probable protein phosphatase 2C 4 [Cajanus c... 79 2e-13 gb|KHN21954.1| Hypothetical protein glysoja_008866 [Glycine soja] 79 3e-13 gb|KYP68184.1| putative protein phosphatase 2C 4 [Cajanus cajan] 79 4e-13 gb|KOM26191.1| hypothetical protein LR48_Vigan238s002400 [Vigna ... 79 4e-13 ref|XP_020215057.1| probable protein phosphatase 2C 4 [Cajanus c... 79 4e-13 ref|XP_017406224.1| PREDICTED: probable protein phosphatase 2C 4... 79 4e-13 ref|XP_014494434.1| probable protein phosphatase 2C 4 [Vigna rad... 79 4e-13 ref|XP_015952257.1| probable protein phosphatase 2C 4 [Arachis d... 79 4e-13 ref|XP_006590985.1| PREDICTED: probable protein phosphatase 2C 4... 79 4e-13 dbj|BAT90721.1| hypothetical protein VIGAN_06200200 [Vigna angul... 79 4e-13 ref|XP_016187289.1| probable protein phosphatase 2C 4 [Arachis i... 79 4e-13 gb|KHN32124.1| Hypothetical protein glysoja_028919 [Glycine soja] 77 8e-13 ref|XP_007132067.1| hypothetical protein PHAVU_011G064200g [Phas... 78 9e-13 ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4... 77 1e-12 >gb|PNX93021.1| putative protein phosphatase 2C 4-like protein [Trifolium pratense] Length = 558 Score = 87.0 bits (214), Expect = 6e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWDDAD 127 GDSRAVLAQKA+PDYW+GKIRQ LERINEETMHDLESWDDAD Sbjct: 330 GDSRAVLAQKAEPDYWIGKIRQDLERINEETMHDLESWDDAD 371 >ref|XP_013456126.1| protein phosphatase 2C family protein [Medicago truncatula] gb|KEH30157.1| protein phosphatase 2C family protein [Medicago truncatula] Length = 704 Score = 87.0 bits (214), Expect = 6e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWDDAD 127 GDSRAVLAQKA+PDYW+GKIRQ LERINEETMHDLESWDDAD Sbjct: 476 GDSRAVLAQKAEPDYWIGKIRQDLERINEETMHDLESWDDAD 517 >ref|XP_004505865.1| PREDICTED: probable protein phosphatase 2C 4 [Cicer arietinum] Length = 724 Score = 87.0 bits (214), Expect = 6e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWDDAD 127 GDSRAVLAQKA+PDYW+GKIRQ LERINEETMHDLESWDDAD Sbjct: 496 GDSRAVLAQKAEPDYWIGKIRQDLERINEETMHDLESWDDAD 537 >dbj|GAU47240.1| hypothetical protein TSUD_87540 [Trifolium subterraneum] Length = 670 Score = 85.5 bits (210), Expect = 2e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWDDAD 127 GDSRAVLAQKA+PDYW+GKIRQ LERINEETMHDLESWDD D Sbjct: 486 GDSRAVLAQKAEPDYWIGKIRQDLERINEETMHDLESWDDTD 527 >ref|XP_019448630.1| PREDICTED: probable protein phosphatase 2C 4 [Lupinus angustifolius] gb|OIW08627.1| hypothetical protein TanjilG_03303 [Lupinus angustifolius] Length = 702 Score = 83.6 bits (205), Expect = 1e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWDDAD 127 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESW+DAD Sbjct: 474 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWEDAD 515 >ref|XP_019454063.1| PREDICTED: probable protein phosphatase 2C 23 [Lupinus angustifolius] gb|OIW05755.1| hypothetical protein TanjilG_23541 [Lupinus angustifolius] Length = 708 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 1/44 (2%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDL-ESWDDADI 130 GDSRAVLAQK +PDYWLGK+RQ LERINEETM+DL ESWDDADI Sbjct: 479 GDSRAVLAQKVEPDYWLGKVRQDLERINEETMNDLDESWDDADI 522 >ref|XP_020214467.1| probable protein phosphatase 2C 4 [Cajanus cajan] Length = 346 Score = 79.0 bits (193), Expect = 2e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 141 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 179 >gb|KHN21954.1| Hypothetical protein glysoja_008866 [Glycine soja] Length = 482 Score = 79.0 bits (193), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 255 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 293 >gb|KYP68184.1| putative protein phosphatase 2C 4 [Cajanus cajan] Length = 663 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 436 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 474 >gb|KOM26191.1| hypothetical protein LR48_Vigan238s002400 [Vigna angularis] Length = 680 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 482 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 520 >ref|XP_020215057.1| probable protein phosphatase 2C 4 [Cajanus cajan] Length = 706 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 479 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 517 >ref|XP_017406224.1| PREDICTED: probable protein phosphatase 2C 4 [Vigna angularis] Length = 709 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 482 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 520 >ref|XP_014494434.1| probable protein phosphatase 2C 4 [Vigna radiata var. radiata] Length = 712 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 485 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 523 >ref|XP_015952257.1| probable protein phosphatase 2C 4 [Arachis duranensis] Length = 714 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 487 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 525 >ref|XP_006590985.1| PREDICTED: probable protein phosphatase 2C 4 [Glycine max] gb|KRH29800.1| hypothetical protein GLYMA_11G139500 [Glycine max] Length = 720 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 493 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 531 >dbj|BAT90721.1| hypothetical protein VIGAN_06200200 [Vigna angularis var. angularis] Length = 739 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 482 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 520 >ref|XP_016187289.1| probable protein phosphatase 2C 4 [Arachis ipaensis] Length = 740 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 513 GDSRAVLAQKAEPDYWLGKIRQDLERINEETMNDLESWD 551 >gb|KHN32124.1| Hypothetical protein glysoja_028919 [Glycine soja] Length = 384 Score = 77.4 bits (189), Expect = 8e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQK +PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 157 GDSRAVLAQKVEPDYWLGKIRQDLERINEETMNDLESWD 195 >ref|XP_007132067.1| hypothetical protein PHAVU_011G064200g [Phaseolus vulgaris] gb|ESW04061.1| hypothetical protein PHAVU_011G064200g [Phaseolus vulgaris] Length = 712 Score = 77.8 bits (190), Expect = 9e-13 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQKA+PDYWLGKI+Q LERINEETM+DLESWD Sbjct: 485 GDSRAVLAQKAEPDYWLGKIKQDLERINEETMNDLESWD 523 >ref|XP_003539674.1| PREDICTED: probable protein phosphatase 2C 4 [Glycine max] gb|KRH24796.1| hypothetical protein GLYMA_12G063100 [Glycine max] Length = 720 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 GDSRAVLAQKADPDYWLGKIRQHLERINEETMHDLESWD 118 GDSRAVLAQK +PDYWLGKIRQ LERINEETM+DLESWD Sbjct: 493 GDSRAVLAQKVEPDYWLGKIRQDLERINEETMNDLESWD 531