BLASTX nr result
ID: Astragalus24_contig00007316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00007316 (343 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020222216.1| uncharacterized protein LOC109804779 [Cajanu... 69 1e-12 gb|AIU48408.1| pollen Ole e 1 allergen and extensin family prote... 66 2e-11 ref|XP_010092125.1| uncharacterized protein LOC21400797 [Morus n... 66 2e-11 ref|XP_014518359.1| uncharacterized protein LOC106775718 [Vigna ... 66 3e-11 ref|XP_017436956.1| PREDICTED: uncharacterized protein LOC108343... 66 3e-11 ref|XP_007150030.1| hypothetical protein PHAVU_005G120100g [Phas... 66 3e-11 ref|XP_007146438.1| hypothetical protein PHAVU_006G040400g [Phas... 66 3e-11 gb|AIU48390.1| pollen Ole e 1 allergen and extensin family prote... 65 4e-11 ref|NP_001235449.1| uncharacterized LOC100527393 precursor [Glyc... 65 7e-11 ref|NP_001237414.1| uncharacterized protein LOC100305581 precurs... 65 7e-11 ref|XP_016183256.1| uncharacterized protein LOC107625192 [Arachi... 64 1e-10 ref|XP_015955324.1| uncharacterized protein LOC107479706 [Arachi... 64 1e-10 ref|XP_019447081.1| PREDICTED: uncharacterized protein LOC109350... 64 2e-10 ref|XP_019418005.1| PREDICTED: uncharacterized protein LOC109328... 64 3e-10 gb|OIV95543.1| hypothetical protein TanjilG_10931 [Lupinus angus... 64 4e-10 dbj|GAU20497.1| hypothetical protein TSUD_130550 [Trifolium subt... 64 5e-10 gb|OIW09498.1| hypothetical protein TanjilG_14128 [Lupinus angus... 64 7e-10 ref|XP_011095371.1| uncharacterized protein LOC105174848 [Sesamu... 62 7e-10 ref|XP_021671903.1| uncharacterized protein LOC110658558 [Hevea ... 62 8e-10 gb|AIU48406.1| pollen Ole e 1 allergen and extensin family prote... 61 1e-09 >ref|XP_020222216.1| uncharacterized protein LOC109804779 [Cajanus cajan] gb|KYP60937.1| hypothetical protein KK1_023359 [Cajanus cajan] Length = 144 Score = 69.3 bits (168), Expect = 1e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSHTVRTFVY+PV+VP Sbjct: 109 GEGSLGVKFSYNHPSGYSHTVRTFVYRPVSVP 140 >gb|AIU48408.1| pollen Ole e 1 allergen and extensin family protein, partial [Phaseolus vulgaris] Length = 121 Score = 65.9 bits (159), Expect = 2e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSH VRTFVY+P +VP Sbjct: 87 GEGSLGVKFSYNHPSGYSHNVRTFVYRPTSVP 118 >ref|XP_010092125.1| uncharacterized protein LOC21400797 [Morus notabilis] gb|EXB50276.1| hypothetical protein L484_017813 [Morus notabilis] Length = 146 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 G+GSLGVKFSYNHPSGYSHTVRTFVY+P VP Sbjct: 111 GQGSLGVKFSYNHPSGYSHTVRTFVYRPANVP 142 >ref|XP_014518359.1| uncharacterized protein LOC106775718 [Vigna radiata var. radiata] Length = 142 Score = 65.9 bits (159), Expect = 3e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSH VRTFVY+P +VP Sbjct: 107 GEGSLGVKFSYNHPSGYSHNVRTFVYRPTSVP 138 >ref|XP_017436956.1| PREDICTED: uncharacterized protein LOC108343284 [Vigna angularis] gb|KOM51448.1| hypothetical protein LR48_Vigan09g010700 [Vigna angularis] dbj|BAT88899.1| hypothetical protein VIGAN_05254400 [Vigna angularis var. angularis] Length = 142 Score = 65.9 bits (159), Expect = 3e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSH VRTFVY+P +VP Sbjct: 107 GEGSLGVKFSYNHPSGYSHNVRTFVYRPTSVP 138 >ref|XP_007150030.1| hypothetical protein PHAVU_005G120100g [Phaseolus vulgaris] gb|ESW22024.1| hypothetical protein PHAVU_005G120100g [Phaseolus vulgaris] Length = 142 Score = 65.9 bits (159), Expect = 3e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSH VRTFVY+P +VP Sbjct: 107 GEGSLGVKFSYNHPSGYSHNVRTFVYRPTSVP 138 >ref|XP_007146438.1| hypothetical protein PHAVU_006G040400g [Phaseolus vulgaris] gb|ESW18432.1| hypothetical protein PHAVU_006G040400g [Phaseolus vulgaris] Length = 142 Score = 65.9 bits (159), Expect = 3e-11 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYNHPSGYSH VRTFVY+P +VP Sbjct: 107 GEGSLGVKFSYNHPSGYSHNVRTFVYRPTSVP 138 >gb|AIU48390.1| pollen Ole e 1 allergen and extensin family protein, partial [Glycine max] Length = 121 Score = 65.1 bits (157), Expect = 4e-11 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGS+GVKFSYNHPSG+SHTVRTFVY+P +VP Sbjct: 87 GEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVP 118 >ref|NP_001235449.1| uncharacterized LOC100527393 precursor [Glycine max] gb|ACU16484.1| unknown [Glycine max] gb|KHM99580.1| hypothetical protein glysoja_006423 [Glycine soja] gb|KRH46133.1| hypothetical protein GLYMA_08G314400 [Glycine max] Length = 144 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGS+GVKFSYNHPSG+SHTVRTFVY+P +VP Sbjct: 109 GEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVP 140 >ref|NP_001237414.1| uncharacterized protein LOC100305581 precursor [Glycine max] gb|ACU13331.1| unknown [Glycine max] gb|KHN19816.1| hypothetical protein glysoja_036733 [Glycine soja] gb|KRG98812.1| hypothetical protein GLYMA_18G099800 [Glycine max] Length = 144 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGS+GVKFSYNHPSG+SHTVRTFVY+P +VP Sbjct: 109 GEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVP 140 >ref|XP_016183256.1| uncharacterized protein LOC107625192 [Arachis ipaensis] Length = 144 Score = 64.3 bits (155), Expect = 1e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 340 EGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 EGS GVKFSYNHPSGYSHTVRTFVY+PV VP Sbjct: 110 EGSSGVKFSYNHPSGYSHTVRTFVYRPVNVP 140 >ref|XP_015955324.1| uncharacterized protein LOC107479706 [Arachis duranensis] Length = 144 Score = 64.3 bits (155), Expect = 1e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 340 EGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 EGS GVKFSYNHPSGYSHTVRTFVY+PV VP Sbjct: 110 EGSSGVKFSYNHPSGYSHTVRTFVYRPVNVP 140 >ref|XP_019447081.1| PREDICTED: uncharacterized protein LOC109350312 [Lupinus angustifolius] Length = 146 Score = 63.9 bits (154), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYN PSGYSHTVRTFVY+P +P Sbjct: 111 GEGSLGVKFSYNRPSGYSHTVRTFVYRPANIP 142 >ref|XP_019418005.1| PREDICTED: uncharacterized protein LOC109328848 [Lupinus angustifolius] ref|XP_019418007.1| PREDICTED: uncharacterized protein LOC109328848 [Lupinus angustifolius] ref|XP_019418008.1| PREDICTED: uncharacterized protein LOC109328848 [Lupinus angustifolius] Length = 147 Score = 63.5 bits (153), Expect = 3e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 G+GSLGVKFSYNHPSGYSHT RTFVY+P +P Sbjct: 112 GKGSLGVKFSYNHPSGYSHTARTFVYRPTDIP 143 >gb|OIV95543.1| hypothetical protein TanjilG_10931 [Lupinus angustifolius] Length = 168 Score = 63.5 bits (153), Expect = 4e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 G+GSLGVKFSYNHPSGYSHT RTFVY+P +P Sbjct: 133 GKGSLGVKFSYNHPSGYSHTARTFVYRPTDIP 164 >dbj|GAU20497.1| hypothetical protein TSUD_130550 [Trifolium subterraneum] Length = 179 Score = 63.5 bits (153), Expect = 5e-10 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 G GS GVKFSYNHPSGYSH VRTFVYKPV VP Sbjct: 145 GGGSAGVKFSYNHPSGYSHAVRTFVYKPVNVP 176 >gb|OIW09498.1| hypothetical protein TanjilG_14128 [Lupinus angustifolius] Length = 222 Score = 63.9 bits (154), Expect = 7e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGSLGVKFSYN PSGYSHTVRTFVY+P +P Sbjct: 187 GEGSLGVKFSYNRPSGYSHTVRTFVYRPANIP 218 >ref|XP_011095371.1| uncharacterized protein LOC105174848 [Sesamum indicum] Length = 146 Score = 62.4 bits (150), Expect = 7e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEG++GVKFSYNHPSGYSHTVR FVY+P VP Sbjct: 111 GEGTVGVKFSYNHPSGYSHTVRPFVYRPAIVP 142 >ref|XP_021671903.1| uncharacterized protein LOC110658558 [Hevea brasiliensis] Length = 147 Score = 62.4 bits (150), Expect = 8e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 GEGS GVKF+YNHPSGYSHTVR FVY+P +VP Sbjct: 112 GEGSTGVKFAYNHPSGYSHTVRPFVYRPASVP 143 >gb|AIU48406.1| pollen Ole e 1 allergen and extensin family protein, partial [Prunus persica] Length = 121 Score = 61.2 bits (147), Expect = 1e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 343 GEGSLGVKFSYNHPSGYSHTVRTFVYKPVTVP 248 G+GS GVKFSYNHPSGYSHTVRTFVY+ +VP Sbjct: 87 GDGSSGVKFSYNHPSGYSHTVRTFVYRQASVP 118