BLASTX nr result
ID: Astragalus24_contig00007295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00007295 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507080.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-10 ref|XP_015969776.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 63 2e-10 ref|XP_015962090.1| pentatricopeptide repeat-containing protein ... 62 1e-09 ref|XP_016204780.1| pentatricopeptide repeat-containing protein ... 62 1e-09 ref|XP_007139658.1| hypothetical protein PHAVU_008G048400g [Phas... 65 1e-09 ref|XP_016196126.1| pentatricopeptide repeat-containing protein ... 62 1e-09 ref|XP_003534476.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-09 ref|XP_020204332.1| pentatricopeptide repeat-containing protein ... 64 6e-09 ref|XP_014497147.1| pentatricopeptide repeat-containing protein ... 62 8e-09 ref|XP_017417588.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-08 ref|XP_003604235.1| PPR containing plant-like protein [Medicago ... 63 6e-08 gb|PNX74685.1| pentatricopeptide repeat-containing protein chlor... 62 1e-07 gb|PNY09319.1| pentatricopeptide repeat-containing protein [Trif... 62 1e-07 ref|XP_019461265.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-07 gb|KRH01026.1| hypothetical protein GLYMA_18G249200 [Glycine max] 61 2e-07 dbj|GAU25547.1| hypothetical protein TSUD_259800 [Trifolium subt... 61 3e-07 ref|XP_018831049.1| PREDICTED: uncharacterized protein LOC108998... 57 2e-06 gb|POE88630.1| pentatricopeptide repeat-containing protein, chlo... 54 2e-06 gb|KHN31112.1| Pentatricopeptide repeat-containing protein, chlo... 58 3e-06 ref|XP_007134416.1| hypothetical protein PHAVU_010G045700g [Phas... 58 3e-06 >ref|XP_004507080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Cicer arietinum] Length = 694 Score = 67.0 bits (162), Expect(2) = 2e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV VTSSL MVMYSK Sbjct: 439 AQLRALEQGKQIHAYALKHWFLPNVSVTSSL-MVMYSK 475 Score = 26.6 bits (57), Expect(2) = 2e-10 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 173 ARRVFEEIYERDVVVWGAMLS 111 ARRVF ER+VV W A++S Sbjct: 381 ARRVFYSSSERNVVCWTALMS 401 >ref|XP_015969776.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Arachis duranensis] Length = 686 Score = 62.8 bits (151), Expect(2) = 2e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ +HAYALKHWFLPN+ +T+SL MVMYSK Sbjct: 431 AQLRALKQGKQVHAYALKHWFLPNINITNSL-MVMYSK 467 Score = 30.4 bits (67), Expect(2) = 2e-10 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 176 LARRVFEEIYERDVVVWGAMLS*GLWN 96 LARRVF ER++V W A++S WN Sbjct: 372 LARRVFYSSAERNLVCWTALMSGYAWN 398 >ref|XP_015962090.1| pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Arachis duranensis] Length = 695 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ +HAYALKHWFLPN +T+SL MVMYSK Sbjct: 440 AQLRALKQGKQVHAYALKHWFLPNASITNSL-MVMYSK 476 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 173 ARRVFEEIYERDVVVWGAMLS*GLWN 96 ARRVF ER++V W A++S WN Sbjct: 382 ARRVFYSSAERNLVCWTALMSGYAWN 407 >ref|XP_016204780.1| pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Arachis ipaensis] Length = 676 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ +HAYALKHWFLPN +T+SL MVMYSK Sbjct: 421 AQLRALKQGKQVHAYALKHWFLPNASITNSL-MVMYSK 457 Score = 28.9 bits (63), Expect(2) = 1e-09 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 173 ARRVFEEIYERDVVVWGAMLS*GLWN 96 ARRVF ER++V W A++S WN Sbjct: 363 ARRVFYSSAERNLVCWTALMSGYAWN 388 >ref|XP_007139658.1| hypothetical protein PHAVU_008G048400g [Phaseolus vulgaris] gb|ESW11652.1| hypothetical protein PHAVU_008G048400g [Phaseolus vulgaris] Length = 674 Score = 65.1 bits (157), Expect(2) = 1e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG IHAYALKHWFLPNV +TS LMM MYSK Sbjct: 422 AQLRALEQGRQIHAYALKHWFLPNVSITSQLMM-MYSK 458 Score = 25.8 bits (55), Expect(2) = 1e-09 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 200 FCDFFITVLARRVFEEIYERDVVVWGAMLS 111 +C + ARRVF ER+VV W A+++ Sbjct: 355 YCKCGDMISARRVFYGSKERNVVCWTALMA 384 >ref|XP_016196126.1| pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Arachis ipaensis] Length = 695 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ +HAYALKHWFLPN +T+SL MVMYSK Sbjct: 440 AQLRALKQGKQVHAYALKHWFLPNASITNSL-MVMYSK 476 Score = 28.5 bits (62), Expect(2) = 1e-09 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 173 ARRVFEEIYERDVVVWGAMLS*GLWN 96 ARRVF ER++V W A++S WN Sbjct: 382 ARRVFYSSPERNLVCWTALMSGYAWN 407 >ref|XP_003534476.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic-like [Glycine max] gb|KHN11550.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gb|KRH40192.1| hypothetical protein GLYMA_09G244300 [Glycine max] Length = 682 Score = 63.5 bits (153), Expect(2) = 1e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV V SSL M MYSK Sbjct: 430 AQLRALEQGKQIHAYALKHWFLPNVSVASSL-MTMYSK 466 Score = 26.9 bits (58), Expect(2) = 1e-09 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 200 FCDFFITVLARRVFEEIYERDVVVWGAMLS 111 +C + ARRVF ER+VV W A++S Sbjct: 363 YCKCGDMISARRVFYGSKERNVVCWTALMS 392 >ref|XP_020204332.1| pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Cajanus cajan] gb|KYP38017.1| hypothetical protein KK1_040757 [Cajanus cajan] Length = 675 Score = 63.9 bits (154), Expect(2) = 6e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALK WFLPNV +TSSLMM MYSK Sbjct: 423 AQLRALEQGKQIHAYALKRWFLPNVSITSSLMM-MYSK 459 Score = 24.3 bits (51), Expect(2) = 6e-09 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 200 FCDFFITVLARRVFEEIYERDVVVWGAMLS 111 +C + ARRVF ER+ V W A+++ Sbjct: 356 YCKCGDMISARRVFYGSNERNAVCWTALMA 385 >ref|XP_014497147.1| pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Vigna radiata var. radiata] Length = 674 Score = 62.0 bits (149), Expect(2) = 8e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG IHAYALK WFLPNV +TS LMM MYSK Sbjct: 422 AQLRALEQGRQIHAYALKRWFLPNVSITSQLMM-MYSK 458 Score = 25.8 bits (55), Expect(2) = 8e-09 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 200 FCDFFITVLARRVFEEIYERDVVVWGAMLS 111 +C + ARRVF ER+VV W A+++ Sbjct: 355 YCKCGDMISARRVFYGSKERNVVCWTALMA 384 >ref|XP_017417588.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Vigna angularis] gb|KOM36953.1| hypothetical protein LR48_Vigan03g033400 [Vigna angularis] dbj|BAT83460.1| hypothetical protein VIGAN_04060800 [Vigna angularis var. angularis] Length = 674 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG IH YALK WFLPNV +TS LMM MYSK Sbjct: 422 AQLRALEQGRQIHVYALKRWFLPNVSITSQLMM-MYSK 458 Score = 25.8 bits (55), Expect(2) = 2e-08 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 200 FCDFFITVLARRVFEEIYERDVVVWGAMLS 111 +C + ARRVF ER+VV W A+++ Sbjct: 355 YCKCGDMISARRVFYGSKERNVVCWTALMA 384 >ref|XP_003604235.1| PPR containing plant-like protein [Medicago truncatula] gb|AES86432.1| PPR containing plant-like protein [Medicago truncatula] Length = 688 Score = 62.8 bits (151), Expect = 6e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV ++SSL +VMYSK Sbjct: 433 AQLRALEQGKQIHAYALKHWFLPNVSLSSSL-VVMYSK 469 >gb|PNX74685.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] gb|PNX75521.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 534 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV ++SSL VMYSK Sbjct: 279 AQLRALEQGKQIHAYALKHWFLPNVSLSSSL-TVMYSK 315 >gb|PNY09319.1| pentatricopeptide repeat-containing protein [Trifolium pratense] Length = 555 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV ++SSL VMYSK Sbjct: 279 AQLRALEQGKQIHAYALKHWFLPNVSLSSSL-TVMYSK 315 >ref|XP_019461265.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71460, chloroplastic [Lupinus angustifolius] Length = 702 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 A+LRAL++G+ +HAYALKHWFLPN +T SL MVMY+K Sbjct: 447 AKLRALDEGKQVHAYALKHWFLPNASLTCSL-MVMYAK 483 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 173 ARRVFEEIYERDVVVWGAMLS 111 ARRVF ER+VV W A++S Sbjct: 389 ARRVFYGCSERNVVCWTALMS 409 >gb|KRH01026.1| hypothetical protein GLYMA_18G249200 [Glycine max] Length = 492 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQ + IHAYALKHWFLP+V VTSSL M MYSK Sbjct: 344 AQLRALEQAKQIHAYALKHWFLPSVSVTSSL-MTMYSK 380 >dbj|GAU25547.1| hypothetical protein TSUD_259800 [Trifolium subterraneum] Length = 535 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRALEQG+ IHAYALKHWFLPNV +++SL VMYSK Sbjct: 279 AQLRALEQGKQIHAYALKHWFLPNVSLSTSL-TVMYSK 315 >ref|XP_018831049.1| PREDICTED: uncharacterized protein LOC108998802 [Juglans regia] Length = 1464 Score = 57.4 bits (137), Expect(2) = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 A+LRAL+QG+ +HA+ALK+WFLPNV + SSL MVMYSK Sbjct: 1207 AELRALKQGKEVHAFALKNWFLPNVSIVSSL-MVMYSK 1243 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 170 RRVFEEIYERDVVVWGAMLS 111 RRVF ER+ + W A++S Sbjct: 1150 RRVFYGSTERNTICWTALMS 1169 >gb|POE88630.1| pentatricopeptide repeat-containing protein, chloroplastic [Quercus suber] Length = 85 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 A+LRAL QG+ +HAYALK+WFLPNV + SL M++YSK Sbjct: 21 AELRALTQGKEVHAYALKNWFLPNVSIVYSL-MILYSK 57 >gb|KHN31112.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 482 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ IHAYAL+HW LPNV + SSL MV+YSK Sbjct: 227 AQLRALKQGKEIHAYALRHWLLPNVPIVSSL-MVLYSK 263 >ref|XP_007134416.1| hypothetical protein PHAVU_010G045700g [Phaseolus vulgaris] gb|ESW06410.1| hypothetical protein PHAVU_010G045700g [Phaseolus vulgaris] Length = 493 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 117 AQLRALEQGEHIHAYALKHWFLPNVFVTSSLMMVMYSK 4 AQLRAL+QG+ IHAYAL+HW LPNV + SSL MV+YSK Sbjct: 237 AQLRALKQGKEIHAYALRHWLLPNVPIVSSL-MVLYSK 273