BLASTX nr result
ID: Astragalus24_contig00006458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00006458 (1339 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU36167.1| hypothetical protein TSUD_275260 [Trifolium subt... 74 3e-10 ref|XP_012568117.1| PREDICTED: KH domain-containing protein At4g... 69 1e-08 >dbj|GAU36167.1| hypothetical protein TSUD_275260 [Trifolium subterraneum] Length = 597 Score = 73.6 bits (179), Expect = 3e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -1 Query: 1327 EARSLPTAYCLLPKPEDQMNQDMTNLWPTLSHLLRGPNLCEDY 1199 + R + A CLLPKPEDQMNQD+TNLWPTL HLLRGPNLC Y Sbjct: 555 QPRCVKPAACLLPKPEDQMNQDLTNLWPTLPHLLRGPNLCGAY 597 >ref|XP_012568117.1| PREDICTED: KH domain-containing protein At4g18375 isoform X2 [Cicer arietinum] Length = 594 Score = 68.6 bits (166), Expect = 1e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 1321 RSLPTAYCLLPKPEDQMNQDMTNLWPTLSHLLRGPNLCEDY 1199 R + A CLLPKPEDQMNQD+TNL PTL+HLLRGPNLC Y Sbjct: 554 RCVKPAACLLPKPEDQMNQDLTNLRPTLTHLLRGPNLCGAY 594