BLASTX nr result
ID: Astragalus24_contig00006380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00006380 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013459615.1| hypothetical protein MTR_3g449840 [Medicago ... 52 3e-06 >ref|XP_013459615.1| hypothetical protein MTR_3g449840 [Medicago truncatula] gb|KEH33646.1| hypothetical protein MTR_3g449840 [Medicago truncatula] Length = 69 Score = 52.0 bits (123), Expect = 3e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 41 MVILTCIKPGMPLFLLNNDWVATGFGIQKEA 133 MV+LTC K G+PLF+L+NDWV TGF IQ EA Sbjct: 1 MVVLTCTKSGLPLFVLSNDWVETGFRIQNEA 31