BLASTX nr result
ID: Astragalus24_contig00006098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00006098 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496170.1| PREDICTED: 50S ribosomal protein L9, chlorop... 109 4e-27 dbj|GAU26596.1| hypothetical protein TSUD_267110 [Trifolium subt... 106 6e-26 ref|XP_019458910.1| PREDICTED: uncharacterized protein LOC109358... 104 3e-25 gb|AFK34975.1| unknown [Lotus japonicus] 103 6e-25 ref|XP_015939092.1| uncharacterized protein LOC107464666 [Arachi... 103 9e-25 ref|XP_020977120.1| uncharacterized protein LOC107639664 isoform... 102 1e-24 gb|KHN01922.1| 50S ribosomal protein L9 [Glycine soja] 102 1e-24 ref|XP_003553907.1| PREDICTED: 50S ribosomal protein L9-like [Gl... 102 1e-24 ref|XP_003613599.1| 50S ribosomal L9-like protein [Medicago trun... 102 2e-24 ref|XP_019438674.1| PREDICTED: uncharacterized protein LOC109344... 102 3e-24 gb|AFK33743.1| unknown [Medicago truncatula] 102 3e-24 ref|XP_016198701.1| uncharacterized protein LOC107639664 isoform... 102 3e-24 ref|XP_013468309.1| 50S ribosomal L9-like protein [Medicago trun... 102 3e-24 gb|ACU23349.1| unknown [Glycine max] 100 3e-24 gb|KHN01095.1| 50S ribosomal protein L9 [Glycine soja] 101 3e-24 ref|XP_003527412.1| PREDICTED: 50S ribosomal protein L9-like [Gl... 101 3e-24 gb|ACU17789.1| unknown [Glycine max] 101 3e-24 ref|XP_014524025.1| uncharacterized protein LOC106780265 [Vigna ... 100 1e-23 ref|XP_014523616.1| uncharacterized protein LOC106779915 isoform... 100 1e-23 ref|XP_016176948.1| uncharacterized protein LOC107619218 [Arachi... 100 1e-23 >ref|XP_004496170.1| PREDICTED: 50S ribosomal protein L9, chloroplastic [Cicer arietinum] Length = 222 Score = 109 bits (272), Expect = 4e-27 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 +ARQLCVNITPENLHLP+PLSTVGEYEVPLRLPRSIALPEGK+NWTLKVKIRSK Sbjct: 169 IARQLCVNITPENLHLPSPLSTVGEYEVPLRLPRSIALPEGKLNWTLKVKIRSK 222 >dbj|GAU26596.1| hypothetical protein TSUD_267110 [Trifolium subterraneum] Length = 222 Score = 106 bits (264), Expect = 6e-26 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNITP+NLHLP+PLST+GEYEVPLRLPRSI LPEGK+NWTLKVKIRSK Sbjct: 169 VARQLCVNITPDNLHLPSPLSTIGEYEVPLRLPRSIPLPEGKLNWTLKVKIRSK 222 >ref|XP_019458910.1| PREDICTED: uncharacterized protein LOC109358883 [Lupinus angustifolius] gb|OIW02993.1| hypothetical protein TanjilG_13630 [Lupinus angustifolius] Length = 224 Score = 104 bits (259), Expect = 3e-25 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHLP+PLST+GEYEVPLRLPRSI+LPEGKVNW++KVKIRSK Sbjct: 171 VARQLCVNIAPENLHLPSPLSTLGEYEVPLRLPRSISLPEGKVNWSMKVKIRSK 224 >gb|AFK34975.1| unknown [Lotus japonicus] Length = 222 Score = 103 bits (257), Expect = 6e-25 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHLP+PLSTVGEYEVPLRLPRSI LPEGKVNW+L+VK+RSK Sbjct: 169 VARQLCVNIAPENLHLPSPLSTVGEYEVPLRLPRSIPLPEGKVNWSLQVKVRSK 222 >ref|XP_015939092.1| uncharacterized protein LOC107464666 [Arachis duranensis] ref|XP_020986445.1| uncharacterized protein LOC107464666 [Arachis duranensis] Length = 224 Score = 103 bits (256), Expect = 9e-25 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHLP PL+T+GEYEVPLRLPRSI LPEGK+NWTLKVKIRSK Sbjct: 171 VARQLCVNIAPENLHLPVPLATLGEYEVPLRLPRSIPLPEGKLNWTLKVKIRSK 224 >ref|XP_020977120.1| uncharacterized protein LOC107639664 isoform X2 [Arachis ipaensis] Length = 184 Score = 102 bits (253), Expect = 1e-24 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHLP PL+T+GEYEVPLRLPRSI LPEGK+NWTLKVKIRS+ Sbjct: 131 VARQLCVNIAPENLHLPVPLATLGEYEVPLRLPRSIPLPEGKLNWTLKVKIRSR 184 >gb|KHN01922.1| 50S ribosomal protein L9 [Glycine soja] Length = 222 Score = 102 bits (255), Expect = 1e-24 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVN+ P+NLHLP+PLST+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 169 VARQLCVNVAPDNLHLPSPLSTLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 222 >ref|XP_003553907.1| PREDICTED: 50S ribosomal protein L9-like [Glycine max] ref|XP_006604123.1| PREDICTED: 50S ribosomal protein L9-like [Glycine max] gb|KRG94443.1| hypothetical protein GLYMA_19G085300 [Glycine max] gb|KRG94444.1| hypothetical protein GLYMA_19G085300 [Glycine max] gb|KRG94445.1| hypothetical protein GLYMA_19G085300 [Glycine max] gb|KRG94446.1| hypothetical protein GLYMA_19G085300 [Glycine max] Length = 222 Score = 102 bits (255), Expect = 1e-24 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVN+ P+NLHLP+PLST+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 169 VARQLCVNVAPDNLHLPSPLSTLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 222 >ref|XP_003613599.1| 50S ribosomal L9-like protein [Medicago truncatula] gb|AES96557.1| 50S ribosomal L9-like protein [Medicago truncatula] Length = 222 Score = 102 bits (253), Expect = 2e-24 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNIT ENLHLP PLST+GEYEVPLRLPRSI LPEGK+NW LKVKIRSK Sbjct: 169 VARQLCVNITAENLHLPTPLSTIGEYEVPLRLPRSIPLPEGKLNWALKVKIRSK 222 >ref|XP_019438674.1| PREDICTED: uncharacterized protein LOC109344371 [Lupinus angustifolius] ref|XP_019438675.1| PREDICTED: uncharacterized protein LOC109344371 [Lupinus angustifolius] gb|OIW14443.1| hypothetical protein TanjilG_15356 [Lupinus angustifolius] Length = 223 Score = 102 bits (253), Expect = 3e-24 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 V+RQLCVNI PENLHLP+PL+T+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 170 VSRQLCVNIAPENLHLPSPLATLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 223 >gb|AFK33743.1| unknown [Medicago truncatula] Length = 224 Score = 102 bits (253), Expect = 3e-24 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNIT ENLHLP PLST+GEYEVPLRLPRSI LPEGK+NW LKVKIRSK Sbjct: 171 VARQLCVNITAENLHLPTPLSTIGEYEVPLRLPRSIPLPEGKLNWALKVKIRSK 224 >ref|XP_016198701.1| uncharacterized protein LOC107639664 isoform X1 [Arachis ipaensis] ref|XP_016198702.1| uncharacterized protein LOC107639664 isoform X1 [Arachis ipaensis] Length = 224 Score = 102 bits (253), Expect = 3e-24 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHLP PL+T+GEYEVPLRLPRSI LPEGK+NWTLKVKIRS+ Sbjct: 171 VARQLCVNIAPENLHLPVPLATLGEYEVPLRLPRSIPLPEGKLNWTLKVKIRSR 224 >ref|XP_013468309.1| 50S ribosomal L9-like protein [Medicago truncatula] gb|KEH42346.1| 50S ribosomal L9-like protein [Medicago truncatula] Length = 224 Score = 102 bits (253), Expect = 3e-24 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNIT ENLHLP PLST+GEYEVPLRLPRSI LPEGK+NW LKVKIRSK Sbjct: 171 VARQLCVNITAENLHLPTPLSTIGEYEVPLRLPRSIPLPEGKLNWALKVKIRSK 224 >gb|ACU23349.1| unknown [Glycine max] Length = 150 Score = 99.8 bits (247), Expect = 3e-24 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 V+RQ+CVN+ P+NLHLP+PL+T+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 97 VSRQICVNVAPDNLHLPSPLATLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 150 >gb|KHN01095.1| 50S ribosomal protein L9 [Glycine soja] Length = 222 Score = 101 bits (252), Expect = 3e-24 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVN+ P+NLHLP+PLST+GEYEVPLR+PRSI LPEGKVNW+LKVK+RSK Sbjct: 169 VARQLCVNVAPDNLHLPSPLSTLGEYEVPLRIPRSIPLPEGKVNWSLKVKVRSK 222 >ref|XP_003527412.1| PREDICTED: 50S ribosomal protein L9-like [Glycine max] gb|KRH55886.1| hypothetical protein GLYMA_06G288700 [Glycine max] gb|KRH55887.1| hypothetical protein GLYMA_06G288700 [Glycine max] gb|KRH55888.1| hypothetical protein GLYMA_06G288700 [Glycine max] gb|KRH55889.1| hypothetical protein GLYMA_06G288700 [Glycine max] Length = 222 Score = 101 bits (252), Expect = 3e-24 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVN+ P+NLHLP+PLST+GEYEVPLR+PRSI LPEGKVNW+LKVK+RSK Sbjct: 169 VARQLCVNVAPDNLHLPSPLSTLGEYEVPLRIPRSIPLPEGKVNWSLKVKVRSK 222 >gb|ACU17789.1| unknown [Glycine max] Length = 222 Score = 101 bits (252), Expect = 3e-24 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVN+ P+NLHLP+PLST+GEYEVPLR+PRSI LPEGKVNW+LKVK+RSK Sbjct: 169 VARQLCVNVAPDNLHLPSPLSTLGEYEVPLRIPRSIPLPEGKVNWSLKVKVRSK 222 >ref|XP_014524025.1| uncharacterized protein LOC106780265 [Vigna radiata var. radiata] Length = 222 Score = 100 bits (248), Expect = 1e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI +NLHLP+PLST+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 169 VARQLCVNIAXDNLHLPSPLSTLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 222 >ref|XP_014523616.1| uncharacterized protein LOC106779915 isoform X2 [Vigna radiata var. radiata] Length = 222 Score = 100 bits (248), Expect = 1e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI +NLHLP+PLST+GEYEVPLRLPRSI LPEGKVNW+LKVKIRSK Sbjct: 169 VARQLCVNIAXDNLHLPSPLSTLGEYEVPLRLPRSIPLPEGKVNWSLKVKIRSK 222 >ref|XP_016176948.1| uncharacterized protein LOC107619218 [Arachis ipaensis] ref|XP_016176949.1| uncharacterized protein LOC107619218 [Arachis ipaensis] Length = 224 Score = 100 bits (248), Expect = 1e-23 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 373 VARQLCVNITPENLHLPAPLSTVGEYEVPLRLPRSIALPEGKVNWTLKVKIRSK 212 VARQLCVNI PENLHL PL+T+GEYEVPLRLPRSI LPEGK+NWTLKVKIRSK Sbjct: 171 VARQLCVNIAPENLHLQVPLATLGEYEVPLRLPRSIPLPEGKLNWTLKVKIRSK 224