BLASTX nr result
ID: Astragalus24_contig00005676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00005676 (322 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY15407.1| pescadillo-like protein, partial [Trifolium prate... 55 2e-06 ref|XP_004513900.1| PREDICTED: pescadillo homolog isoform X1 [Ci... 55 2e-06 ref|XP_017413278.1| PREDICTED: pescadillo homolog [Vigna angular... 55 2e-06 ref|XP_014513366.1| pescadillo homolog [Vigna radiata var. radiata] 55 2e-06 ref|XP_004513899.1| PREDICTED: pescadillo homolog isoform X2 [Ci... 55 2e-06 ref|XP_020219449.1| pescadillo homolog [Cajanus cajan] >gi|10123... 55 2e-06 ref|XP_020203485.1| pescadillo homolog [Cajanus cajan] >gi|10123... 55 2e-06 ref|XP_007143421.1| hypothetical protein PHAVU_007G070900g [Phas... 55 2e-06 gb|KHN43308.1| Pescadillo like [Glycine soja] 55 2e-06 ref|XP_003554639.1| PREDICTED: pescadillo homolog [Glycine max] ... 55 2e-06 ref|XP_004509849.1| PREDICTED: pescadillo homolog [Cicer arietinum] 55 2e-06 ref|XP_021599375.1| pescadillo homolog [Manihot esculenta] >gi|1... 55 2e-06 ref|XP_004508710.1| PREDICTED: pescadillo homolog [Cicer arietinum] 55 2e-06 gb|AFK42806.1| unknown [Medicago truncatula] 54 4e-06 ref|XP_010554197.1| PREDICTED: pescadillo homolog [Tarenaya hass... 54 5e-06 ref|XP_021691760.1| pescadillo homolog [Hevea brasiliensis] 54 5e-06 ref|XP_003625519.2| pescadillo-like protein [Medicago truncatula... 54 6e-06 ref|XP_019576338.1| PREDICTED: pescadillo homolog [Rhinolophus s... 54 7e-06 dbj|GAV70232.1| BRCT domain-containing protein/Pescadillo_N doma... 54 7e-06 gb|OEL24605.1| Pescadillo-like protein [Dichanthelium oligosanthes] 54 7e-06 >gb|PNY15407.1| pescadillo-like protein, partial [Trifolium pratense] Length = 372 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 +N+KSELRLAQ+QHQLPSNE GALMHLVE+ Sbjct: 70 QNKKSELRLAQLQHQLPSNEPGALMHLVEK 99 >ref|XP_004513900.1| PREDICTED: pescadillo homolog isoform X1 [Cicer arietinum] Length = 464 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 ENEKSELRLAQ+Q+QLPSNE GALMHLVE+ Sbjct: 157 ENEKSELRLAQLQNQLPSNEPGALMHLVEK 186 >ref|XP_017413278.1| PREDICTED: pescadillo homolog [Vigna angularis] gb|KOM35964.1| hypothetical protein LR48_Vigan02g211400 [Vigna angularis] dbj|BAT94213.1| hypothetical protein VIGAN_08079200 [Vigna angularis var. angularis] Length = 597 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 318 NEKSELRLAQIQHQLPSNESGALMHLVEE 232 NE SELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 299 NETSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_014513366.1| pescadillo homolog [Vigna radiata var. radiata] Length = 598 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 318 NEKSELRLAQIQHQLPSNESGALMHLVEE 232 NE SELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 299 NETSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_004513899.1| PREDICTED: pescadillo homolog isoform X2 [Cicer arietinum] Length = 598 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 ENEKSELRLAQ+Q+QLPSNE GALMHLVE+ Sbjct: 291 ENEKSELRLAQLQNQLPSNEPGALMHLVEK 320 >ref|XP_020219449.1| pescadillo homolog [Cajanus cajan] gb|KYP64307.1| Pescadillo isogeny [Cajanus cajan] Length = 601 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 315 EKSELRLAQIQHQLPSNESGALMHLVEE 232 EKSELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 300 EKSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_020203485.1| pescadillo homolog [Cajanus cajan] gb|KYP38973.1| Pescadillo isogeny [Cajanus cajan] Length = 601 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 315 EKSELRLAQIQHQLPSNESGALMHLVEE 232 EKSELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 300 EKSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_007143421.1| hypothetical protein PHAVU_007G070900g [Phaseolus vulgaris] gb|ESW15415.1| hypothetical protein PHAVU_007G070900g [Phaseolus vulgaris] Length = 601 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 315 EKSELRLAQIQHQLPSNESGALMHLVEE 232 EKSELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 300 EKSELRLAQLQHQLPSNEPGALMHLVEE 327 >gb|KHN43308.1| Pescadillo like [Glycine soja] Length = 603 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 318 NEKSELRLAQIQHQLPSNESGALMHLVEE 232 NE SELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 299 NETSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_003554639.1| PREDICTED: pescadillo homolog [Glycine max] gb|KRG96785.1| hypothetical protein GLYMA_19G232500 [Glycine max] Length = 603 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 318 NEKSELRLAQIQHQLPSNESGALMHLVEE 232 NE SELRLAQ+QHQLPSNE GALMHLVEE Sbjct: 299 NETSELRLAQLQHQLPSNEPGALMHLVEE 327 >ref|XP_004509849.1| PREDICTED: pescadillo homolog [Cicer arietinum] Length = 604 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 ENEKSELRLAQ+Q+QLPSNE GALMHLVE+ Sbjct: 297 ENEKSELRLAQLQNQLPSNEPGALMHLVEK 326 >ref|XP_021599375.1| pescadillo homolog [Manihot esculenta] gb|OAY25693.1| hypothetical protein MANES_17G112500 [Manihot esculenta] Length = 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/54 (53%), Positives = 36/54 (66%), Gaps = 9/54 (16%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEEPQ---------VPCTKDFELCLFF 187 ENE+SE+RLAQ+QHQLPSNE GALMHLV++ + + C K F FF Sbjct: 300 ENEESEIRLAQLQHQLPSNEPGALMHLVQDVESENEDDQDTMECKKLFRNMKFF 353 >ref|XP_004508710.1| PREDICTED: pescadillo homolog [Cicer arietinum] Length = 663 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 ENEKSELRLAQ+Q+QLPSNE GALMHLVE+ Sbjct: 356 ENEKSELRLAQLQNQLPSNEPGALMHLVEK 385 >gb|AFK42806.1| unknown [Medicago truncatula] Length = 242 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 +NEKSELRLAQ+QHQLPSNE GALM LVE+ Sbjct: 81 QNEKSELRLAQLQHQLPSNEPGALMQLVEK 110 >ref|XP_010554197.1| PREDICTED: pescadillo homolog [Tarenaya hassleriana] ref|XP_010554283.1| PREDICTED: pescadillo homolog [Tarenaya hassleriana] Length = 595 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -2 Query: 318 NEKSELRLAQIQHQLPSNESGALMHLVEEPQVPCTKDFELC 196 NE+S+LRL+Q+QHQLPSNE GALMHLV +V ++ ++C Sbjct: 291 NEESDLRLSQLQHQLPSNEPGALMHLVANEEVEDDEETKVC 331 >ref|XP_021691760.1| pescadillo homolog [Hevea brasiliensis] Length = 608 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEEPQ 226 ENE+SE+RLAQ+QHQLP+NE GALMHLV++ + Sbjct: 300 ENEESEIRLAQLQHQLPTNEPGALMHLVQDAE 331 >ref|XP_003625519.2| pescadillo-like protein [Medicago truncatula] gb|AES81737.2| pescadillo-like protein [Medicago truncatula] Length = 487 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEE 232 +NEKSELRLAQ+QHQLPSNE GALM LVE+ Sbjct: 178 QNEKSELRLAQLQHQLPSNEPGALMQLVEK 207 >ref|XP_019576338.1| PREDICTED: pescadillo homolog [Rhinolophus sinicus] Length = 585 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEEPQVPCTKDFELC 196 + E+SELRLAQ+QHQLPS+E+GALMHLV + +V ++ +C Sbjct: 290 DREESELRLAQLQHQLPSSEAGALMHLVTDKEVEEDEETRVC 331 >dbj|GAV70232.1| BRCT domain-containing protein/Pescadillo_N domain-containing protein [Cephalotus follicularis] Length = 587 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 321 ENEKSELRLAQIQHQLPSNESGALMHLVEEPQVPCTKD 208 + ++SELRLAQ+QHQLPSNE GALMHLVE+ V D Sbjct: 288 QTDESELRLAQLQHQLPSNEPGALMHLVEDAAVETEDD 325 >gb|OEL24605.1| Pescadillo-like protein [Dichanthelium oligosanthes] Length = 596 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 315 EKSELRLAQIQHQLPSNESGALMHLVEEPQVPCTKDFE 202 ++SELRLAQ+QHQLP+NE GALMHLVEE T D E Sbjct: 299 DESELRLAQLQHQLPANEPGALMHLVEESTAADTDDDE 336