BLASTX nr result
ID: Astragalus24_contig00001955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00001955 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH11828.1| hypothetical protein GLYMA_15G133000 [Glycine max] 55 4e-07 >gb|KRH11828.1| hypothetical protein GLYMA_15G133000 [Glycine max] Length = 92 Score = 54.7 bits (130), Expect = 4e-07 Identities = 35/71 (49%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +3 Query: 12 FLHYRFHLQKPLLNPTCFPLLSTI--TIIMLSHHSS*ATTLVSFTASAQNESQV*IHRST 185 FLH+ FHLQKPL PTCFP LSTI T +LS S A TL+S ++ Q ESQV I Sbjct: 22 FLHFPFHLQKPLTKPTCFPHLSTIIVTFCLLSSASILAITLLS-SSKGQYESQVQIMGQC 80 Query: 186 AFASKMAAKNG 218 +S+ + G Sbjct: 81 LQSSREQKEEG 91