BLASTX nr result
ID: Astragalus24_contig00001460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00001460 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR07600.1| fiber dTDP-glucose 4-6-dehydratase, partial [Goss... 108 7e-27 gb|POF07961.1| udp-glucuronic acid decarboxylase 5 [Quercus suber] 103 1e-26 ref|XP_017406294.1| PREDICTED: UDP-glucuronic acid decarboxylase... 110 3e-26 ref|XP_021610827.1| UDP-glucuronic acid decarboxylase 6 [Manihot... 110 3e-26 gb|KYP68207.1| UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] 104 3e-26 ref|XP_007132085.1| hypothetical protein PHAVU_011G065700g [Phas... 110 4e-26 gb|AFW90530.1| UDP-glucuronic acid decarboxylase 1-like isoform ... 110 4e-26 ref|XP_004487023.1| PREDICTED: UDP-glucuronic acid decarboxylase... 109 5e-26 ref|XP_004487020.1| PREDICTED: UDP-glucuronic acid decarboxylase... 109 9e-26 ref|XP_003597351.1| UDP-glucuronic acid decarboxylase [Medicago ... 109 9e-26 ref|XP_020214311.1| UDP-glucuronic acid decarboxylase 6-like [Ca... 108 1e-25 ref|XP_016740563.1| PREDICTED: UDP-glucuronic acid decarboxylase... 108 1e-25 gb|KJB20139.1| hypothetical protein B456_003G134600 [Gossypium r... 108 1e-25 ref|XP_014493872.1| UDP-glucuronic acid decarboxylase 6-like [Vi... 108 1e-25 ref|XP_022729234.1| UDP-glucuronic acid decarboxylase 6-like [Du... 108 2e-25 ref|XP_012471379.1| PREDICTED: UDP-glucuronic acid decarboxylase... 108 2e-25 ref|XP_015874135.1| PREDICTED: UDP-glucuronic acid decarboxylase... 103 2e-25 gb|OMO67724.1| NAD-dependent epimerase/dehydratase [Corchorus ca... 108 2e-25 ref|XP_015952274.1| UDP-glucuronic acid decarboxylase 6 [Arachis... 108 2e-25 ref|XP_021658337.1| UDP-glucuronic acid decarboxylase 6 isoform ... 108 2e-25 >gb|AAR07600.1| fiber dTDP-glucose 4-6-dehydratase, partial [Gossypium barbadense] Length = 181 Score = 108 bits (269), Expect = 7e-27 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 121 LINPKVEIKMVENTPDDPRQRKPDIPKAKELLGWEPKVKLRDGLPLMEEDFRLR 174 >gb|POF07961.1| udp-glucuronic acid decarboxylase 5 [Quercus suber] Length = 69 Score = 103 bits (258), Expect = 1e-26 Identities = 49/54 (90%), Positives = 50/54 (92%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIK VENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFR R Sbjct: 9 LINPEVEIKKVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRQR 62 >ref|XP_017406294.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vigna angularis] ref|XP_017406295.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vigna angularis] ref|XP_017406296.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vigna angularis] ref|XP_017406297.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vigna angularis] gb|KOM26176.1| hypothetical protein LR48_Vigan238s000900 [Vigna angularis] dbj|BAT90705.1| hypothetical protein VIGAN_06198500 [Vigna angularis var. angularis] Length = 342 Score = 110 bits (275), Expect = 3e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 282 LINPAVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 335 >ref|XP_021610827.1| UDP-glucuronic acid decarboxylase 6 [Manihot esculenta] ref|XP_021610828.1| UDP-glucuronic acid decarboxylase 6 [Manihot esculenta] gb|OAY51788.1| hypothetical protein MANES_04G032900 [Manihot esculenta] gb|OAY51789.1| hypothetical protein MANES_04G032900 [Manihot esculenta] Length = 346 Score = 110 bits (275), Expect = 3e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 286 LINPAVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 339 >gb|KYP68207.1| UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] Length = 124 Score = 104 bits (260), Expect = 3e-26 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIK V+NTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 64 LINPNVEIKTVDNTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 117 >ref|XP_007132085.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] ref|XP_007132086.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] ref|XP_007132087.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] gb|AGV54384.1| UDP-glucuronic acid decarboxylase [Phaseolus vulgaris] gb|ESW04079.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] gb|ESW04080.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] gb|ESW04081.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris] Length = 342 Score = 110 bits (274), Expect = 4e-26 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA+ELLGWEPK+KLRDGLPLMEEDFRLR Sbjct: 282 LINPAVEIKMVENTPDDPRQRKPDITKAKELLGWEPKIKLRDGLPLMEEDFRLR 335 >gb|AFW90530.1| UDP-glucuronic acid decarboxylase 1-like isoform 1 [Phaseolus vulgaris] Length = 342 Score = 110 bits (274), Expect = 4e-26 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA+ELLGWEPK+KLRDGLPLMEEDFRLR Sbjct: 282 LINPAVEIKMVENTPDDPRQRKPDITKAKELLGWEPKIKLRDGLPLMEEDFRLR 335 >ref|XP_004487023.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X2 [Cicer arietinum] Length = 314 Score = 109 bits (272), Expect = 5e-26 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 254 LINPAVEIKMVENTPDDPRQRKPDITKATELLGWEPKVKLRDGLPLMEEDFRLR 307 >ref|XP_004487020.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Cicer arietinum] ref|XP_004487021.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Cicer arietinum] ref|XP_012571559.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Cicer arietinum] Length = 350 Score = 109 bits (272), Expect = 9e-26 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 290 LINPAVEIKMVENTPDDPRQRKPDITKATELLGWEPKVKLRDGLPLMEEDFRLR 343 >ref|XP_003597351.1| UDP-glucuronic acid decarboxylase [Medicago truncatula] gb|ACJ85406.1| unknown [Medicago truncatula] gb|AES67602.1| UDP-glucuronic acid decarboxylase [Medicago truncatula] Length = 351 Score = 109 bits (272), Expect = 9e-26 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI KA ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 291 LINPAVEIKMVENTPDDPRQRKPDITKATELLGWEPKVKLRDGLPLMEEDFRLR 344 >ref|XP_020214311.1| UDP-glucuronic acid decarboxylase 6-like [Cajanus cajan] ref|XP_020214312.1| UDP-glucuronic acid decarboxylase 6-like [Cajanus cajan] ref|XP_020214313.1| UDP-glucuronic acid decarboxylase 6-like [Cajanus cajan] gb|KYP68206.1| UDP-glucuronic acid decarboxylase 1 [Cajanus cajan] Length = 346 Score = 108 bits (271), Expect = 1e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 286 LINPGVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 339 >ref|XP_016740563.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X2 [Gossypium hirsutum] Length = 328 Score = 108 bits (270), Expect = 1e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 268 LINPKVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 321 >gb|KJB20139.1| hypothetical protein B456_003G134600 [Gossypium raimondii] Length = 328 Score = 108 bits (270), Expect = 1e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 268 LINPKVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 321 >ref|XP_014493872.1| UDP-glucuronic acid decarboxylase 6-like [Vigna radiata var. radiata] ref|XP_014494136.1| UDP-glucuronic acid decarboxylase 6 [Vigna radiata var. radiata] ref|XP_014494137.1| UDP-glucuronic acid decarboxylase 6 [Vigna radiata var. radiata] ref|XP_014494138.1| UDP-glucuronic acid decarboxylase 6 [Vigna radiata var. radiata] ref|XP_014494139.1| UDP-glucuronic acid decarboxylase 6 [Vigna radiata var. radiata] ref|XP_022634163.1| UDP-glucuronic acid decarboxylase 6 [Vigna radiata var. radiata] Length = 342 Score = 108 bits (270), Expect = 1e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEIKMVENTPDDPRQRKPDI A+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 282 LINPAVEIKMVENTPDDPRQRKPDITNAKELLGWEPKVKLRDGLPLMEEDFRLR 335 >ref|XP_022729234.1| UDP-glucuronic acid decarboxylase 6-like [Durio zibethinus] ref|XP_022729235.1| UDP-glucuronic acid decarboxylase 6-like [Durio zibethinus] ref|XP_022729236.1| UDP-glucuronic acid decarboxylase 6-like [Durio zibethinus] ref|XP_022729237.1| UDP-glucuronic acid decarboxylase 6-like [Durio zibethinus] Length = 346 Score = 108 bits (270), Expect = 2e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 286 LINPEVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 339 >ref|XP_012471379.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Gossypium raimondii] ref|XP_016740561.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Gossypium hirsutum] gb|KJB20137.1| hypothetical protein B456_003G134600 [Gossypium raimondii] gb|KJB20138.1| hypothetical protein B456_003G134600 [Gossypium raimondii] gb|PPD70930.1| hypothetical protein GOBAR_DD32194 [Gossypium barbadense] Length = 346 Score = 108 bits (270), Expect = 2e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 286 LINPKVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 339 >ref|XP_015874135.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Ziziphus jujuba] Length = 145 Score = 103 bits (257), Expect = 2e-25 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINPAVEI MVENTPDDPRQRKPDI A++LLGWEPK+KLR+GLPLMEEDFRLR Sbjct: 85 LINPAVEINMVENTPDDPRQRKPDITNAKQLLGWEPKIKLREGLPLMEEDFRLR 138 >gb|OMO67724.1| NAD-dependent epimerase/dehydratase [Corchorus capsularis] Length = 362 Score = 108 bits (270), Expect = 2e-25 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDIAKA+ELLGWEPKVKLR+GLPLMEEDFRLR Sbjct: 302 LINPEVEIKMVENTPDDPRQRKPDIAKAKELLGWEPKVKLREGLPLMEEDFRLR 355 >ref|XP_015952274.1| UDP-glucuronic acid decarboxylase 6 [Arachis duranensis] ref|XP_015952276.1| UDP-glucuronic acid decarboxylase 6 [Arachis duranensis] ref|XP_015952277.1| UDP-glucuronic acid decarboxylase 6 [Arachis duranensis] ref|XP_016187307.1| UDP-glucuronic acid decarboxylase 6 [Arachis ipaensis] ref|XP_020992931.1| UDP-glucuronic acid decarboxylase 6 [Arachis duranensis] ref|XP_020992932.1| UDP-glucuronic acid decarboxylase 6 [Arachis duranensis] Length = 342 Score = 108 bits (269), Expect = 2e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 282 LINPDVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 335 >ref|XP_021658337.1| UDP-glucuronic acid decarboxylase 6 isoform X3 [Hevea brasiliensis] ref|XP_021658338.1| UDP-glucuronic acid decarboxylase 6 isoform X3 [Hevea brasiliensis] ref|XP_021658339.1| UDP-glucuronic acid decarboxylase 6 isoform X3 [Hevea brasiliensis] Length = 346 Score = 108 bits (269), Expect = 2e-25 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -3 Query: 430 LINPAVEIKMVENTPDDPRQRKPDIAKARELLGWEPKVKLRDGLPLMEEDFRLR 269 LINP VEIKMVENTPDDPRQRKPDI KA+ELLGWEPKVKLRDGLPLMEEDFRLR Sbjct: 286 LINPDVEIKMVENTPDDPRQRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRLR 339