BLASTX nr result
ID: Astragalus24_contig00000437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00000437 (842 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013449459.1| hypothetical protein MTR_7g083585 [Medicago ... 69 3e-11 gb|PNY16904.1| hypothetical protein L195_g013633 [Trifolium prat... 68 1e-10 dbj|GAU39410.1| hypothetical protein TSUD_323580 [Trifolium subt... 68 7e-10 ref|XP_004493009.1| PREDICTED: cysteine-rich and transmembrane d... 63 7e-09 gb|KHN28561.1| hypothetical protein glysoja_021382 [Glycine soja] 62 1e-08 ref|XP_003553296.1| PREDICTED: cysteine-rich and transmembrane d... 62 2e-08 ref|XP_019429678.1| PREDICTED: cysteine-rich and transmembrane d... 55 7e-06 ref|XP_003518125.1| PREDICTED: cysteine-rich and transmembrane d... 55 7e-06 >ref|XP_013449459.1| hypothetical protein MTR_7g083585 [Medicago truncatula] gb|KEH23487.1| hypothetical protein MTR_7g083585 [Medicago truncatula] Length = 116 Score = 69.3 bits (168), Expect = 3e-11 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -2 Query: 442 PQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHEN---SGCGSFLHG 311 PQY+SYQGYF++GY PNYHCHHVQHH H+N SGC SF G Sbjct: 64 PQYQSYQGYFNDGYPPPPPPPNYHCHHVQHHCHDNDHGSGCTSFFQG 110 >gb|PNY16904.1| hypothetical protein L195_g013633 [Trifolium pratense] Length = 125 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = -2 Query: 445 RPQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRH---ENSGCGSFLHG 311 RPQYESYQGYF++GY PNYHCHHVQHH H E+S GSF G Sbjct: 66 RPQYESYQGYFNDGYPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQG 113 >dbj|GAU39410.1| hypothetical protein TSUD_323580 [Trifolium subterraneum] Length = 202 Score = 67.8 bits (164), Expect = 7e-10 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -2 Query: 445 RPQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHE--NSGCGSFLHG 311 RPQY SYQGYF++GY PNYHCHHVQHH H+ +SG GSF G Sbjct: 64 RPQYNSYQGYFNDGYPPPPPPPNYHCHHVQHHCHDHNDSGFGSFFQG 110 >ref|XP_004493009.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Cicer arietinum] Length = 124 Score = 63.2 bits (152), Expect = 7e-09 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 445 RPQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHE--NSGCGSFLHG 311 RPQ+ESYQGYF++GY PNYHCH VQHH H+ N+G SF G Sbjct: 62 RPQHESYQGYFNDGYPPPPPPPNYHCHQVQHHCHDDNNAGFSSFFQG 108 >gb|KHN28561.1| hypothetical protein glysoja_021382 [Glycine soja] Length = 100 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 442 PQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHENSGCGSFLHG 311 PQYE YQGYF+ GY NYHCHH QHH ++N G SFL G Sbjct: 50 PQYEGYQGYFNHGYPLPPPP-NYHCHHAQHHHNDNPGFTSFLQG 92 >ref|XP_003553296.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Glycine max] gb|KRG94664.1| hypothetical protein GLYMA_19G100100 [Glycine max] Length = 109 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -2 Query: 442 PQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHENSGCGSFLHG 311 PQYE YQGYF+ GY NYHCHH QHH ++N G SFL G Sbjct: 50 PQYEGYQGYFNHGYPLPPPP-NYHCHHAQHHHNDNPGFTSFLQG 92 >ref|XP_019429678.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Lupinus angustifolius] Length = 119 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -2 Query: 445 RPQYESYQGYFSEGYXXXXXXPNYHCHHVQHHRHENSGCGSFLHG 311 RPQYE YQGYF+ GY P+YHCH HH +SG GSFL G Sbjct: 61 RPQYEGYQGYFNGGYPPPPPPPHYHCH---HHGDGDSGFGSFLQG 102 >ref|XP_003518125.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Glycine max] gb|KRH70051.1| hypothetical protein GLYMA_02G065200 [Glycine max] gb|KRH70052.1| hypothetical protein GLYMA_02G065200 [Glycine max] Length = 119 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/46 (54%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 445 RPQYESYQGYFSEGYXXXXXXPNYHCHHV-QHHRHENSGCGSFLHG 311 RP Y+SYQGYF G+ P+YH HV HH HE GC SFL G Sbjct: 58 RPPYDSYQGYFDNGHPPPPPPPHYHYQHVDHHHHHEEPGCFSFLRG 103