BLASTX nr result
ID: Astragalus24_contig00000411
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00000411 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH51954.1| hypothetical protein GLYMA_06G037500 [Glycine max] 57 2e-08 >gb|KRH51954.1| hypothetical protein GLYMA_06G037500 [Glycine max] Length = 67 Score = 57.4 bits (137), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 313 LHSAYLLLMSSINGVCPISSSIHAWIMRMRHSISITII 426 LHSAYLLL+SSIN V PISSSI+AW++R SISITII Sbjct: 4 LHSAYLLLVSSINRVSPISSSIYAWVVRWWQSISITII 41