BLASTX nr result
ID: Astragalus23_contig00033902
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00033902 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK49285.1| unknown [Lotus japonicus] 71 2e-13 ref|XP_013446941.1| polyphosphoinositide-binding protein [Medica... 72 1e-12 ref|XP_013446942.1| polyphosphoinositide-binding protein [Medica... 72 1e-12 ref|XP_020224064.1| random slug protein 5 [Cajanus cajan] >gi|10... 72 1e-12 dbj|GAU42646.1| hypothetical protein TSUD_398510 [Trifolium subt... 72 2e-12 dbj|GAU25463.1| hypothetical protein TSUD_71170 [Trifolium subte... 70 3e-12 gb|PNY11462.1| random slug protein 5-like [Trifolium pratense] 70 4e-12 ref|XP_014523115.1| random slug protein 5 [Vigna radiata var. ra... 70 6e-12 ref|XP_017406154.1| PREDICTED: random slug protein 5-like [Vigna... 70 6e-12 ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phas... 70 6e-12 ref|XP_004503847.1| PREDICTED: random slug protein 5-like [Cicer... 70 6e-12 gb|PNY16821.1| random slug protein 5-like [Trifolium pratense] 70 1e-11 ref|XP_011082916.1| random slug protein 5-like [Sesamum indicum] 70 1e-11 gb|KDP22526.1| hypothetical protein JCGZ_26357 [Jatropha curcas] 69 2e-11 gb|AFK46517.1| unknown [Medicago truncatula] 69 2e-11 ref|XP_003602742.1| polyphosphoinositide-binding protein [Medica... 69 2e-11 ref|XP_012090572.1| random slug protein 5 isoform X2 [Jatropha c... 69 2e-11 ref|XP_012090573.1| random slug protein 5 isoform X1 [Jatropha c... 69 2e-11 ref|XP_013446940.1| polyphosphoinositide-binding protein [Medica... 69 2e-11 ref|XP_004501761.1| PREDICTED: random slug protein 5-like [Cicer... 69 2e-11 >gb|AFK49285.1| unknown [Lotus japonicus] Length = 110 Score = 70.9 bits (172), Expect = 2e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FV+N KLKSTLLEEIDE+QLPEIYGGQ+ LVPIQDS Sbjct: 71 KKIVFVDNKKLKSTLLEEIDESQLPEIYGGQLPLVPIQDS 110 >ref|XP_013446941.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20968.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 253 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN+KLKSTLLE+IDE+QLPEIYGG++QLVPIQDS Sbjct: 213 KKIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 252 >ref|XP_013446942.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20969.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 263 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN+KLKSTLLE+IDE+QLPEIYGG++QLVPIQDS Sbjct: 223 KKIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 262 >ref|XP_020224064.1| random slug protein 5 [Cajanus cajan] gb|KYP59721.1| Random slug protein 5 [Cajanus cajan] Length = 246 Score = 72.0 bits (175), Expect = 1e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 +KI FVEN KLKSTLLEEIDE+QLPEIYGGQM LVPIQDS Sbjct: 207 RKIVFVENKKLKSTLLEEIDESQLPEIYGGQMPLVPIQDS 246 >dbj|GAU42646.1| hypothetical protein TSUD_398510 [Trifolium subterraneum] Length = 268 Score = 72.0 bits (175), Expect = 2e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLEEIDE+QLPEIYGGQ+ LVPIQDS Sbjct: 229 KKIVFVENKKLKSTLLEEIDESQLPEIYGGQLALVPIQDS 268 >dbj|GAU25463.1| hypothetical protein TSUD_71170 [Trifolium subterraneum] Length = 204 Score = 70.5 bits (171), Expect = 3e-12 Identities = 32/40 (80%), Positives = 39/40 (97%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN+K+KSTLLE+IDE+QLPEIYGG++QLVP+QDS Sbjct: 165 KKIIFVENNKVKSTLLEDIDESQLPEIYGGKLQLVPVQDS 204 >gb|PNY11462.1| random slug protein 5-like [Trifolium pratense] Length = 204 Score = 70.1 bits (170), Expect = 4e-12 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN+KLKSTLLE+IDE+QLPEIYGG++QLVPIQ+S Sbjct: 165 KKIIFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQNS 204 >ref|XP_014523115.1| random slug protein 5 [Vigna radiata var. radiata] Length = 263 Score = 70.5 bits (171), Expect = 6e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLEEI+E+QLP+IYGGQM LVPIQDS Sbjct: 224 KKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQDS 263 >ref|XP_017406154.1| PREDICTED: random slug protein 5-like [Vigna angularis] gb|KOM26061.1| hypothetical protein LR48_Vigan221s002300 [Vigna angularis] dbj|BAU03061.1| hypothetical protein VIGAN_UM006500 [Vigna angularis var. angularis] Length = 263 Score = 70.5 bits (171), Expect = 6e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLEEI+E+QLP+IYGGQM LVPIQDS Sbjct: 224 KKIVFVENKKLKSTLLEEIEESQLPDIYGGQMALVPIQDS 263 >ref|XP_007137847.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] gb|ESW09841.1| hypothetical protein PHAVU_009G160800g [Phaseolus vulgaris] Length = 264 Score = 70.5 bits (171), Expect = 6e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLEEI+E+QLP+IYGGQM LVPIQDS Sbjct: 225 KKIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQDS 264 >ref|XP_004503847.1| PREDICTED: random slug protein 5-like [Cicer arietinum] Length = 274 Score = 70.5 bits (171), Expect = 6e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVE++KLKSTL EEIDE+QLPEIYGGQ+QL+PIQDS Sbjct: 235 KKIVFVESNKLKSTLQEEIDESQLPEIYGGQLQLIPIQDS 274 >gb|PNY16821.1| random slug protein 5-like [Trifolium pratense] Length = 262 Score = 69.7 bits (169), Expect = 1e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVE KLKSTLLEEIDE+QLPEIYGGQ+ LVPIQDS Sbjct: 223 KKIVFVETKKLKSTLLEEIDESQLPEIYGGQLALVPIQDS 262 >ref|XP_011082916.1| random slug protein 5-like [Sesamum indicum] Length = 274 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KL++TLLEEIDE+QLPEIYGG+MQLVPIQD+ Sbjct: 235 KKIIFVENKKLQATLLEEIDESQLPEIYGGKMQLVPIQDA 274 >gb|KDP22526.1| hypothetical protein JCGZ_26357 [Jatropha curcas] Length = 241 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLE+IDE+Q+PEIYGG+M LVPIQD+ Sbjct: 202 KKIVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPIQDN 241 >gb|AFK46517.1| unknown [Medicago truncatula] Length = 272 Score = 69.3 bits (168), Expect = 2e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLK+TLLEEIDE+QLPEIYGG++ LVPIQDS Sbjct: 233 KKIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >ref|XP_003602742.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|AES72993.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|AFK48922.1| unknown [Medicago truncatula] Length = 272 Score = 69.3 bits (168), Expect = 2e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLK+TLLEEIDE+QLPEIYGG++ LVPIQDS Sbjct: 233 KKIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >ref|XP_012090572.1| random slug protein 5 isoform X2 [Jatropha curcas] Length = 247 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLE+IDE+Q+PEIYGG+M LVPIQD+ Sbjct: 208 KKIVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPIQDN 247 >ref|XP_012090573.1| random slug protein 5 isoform X1 [Jatropha curcas] dbj|BAJ53120.1| JHL07K02.10 [Jatropha curcas] Length = 253 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 KKI FVEN KLKSTLLE+IDE+Q+PEIYGG+M LVPIQD+ Sbjct: 214 KKIVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPIQDN 253 >ref|XP_013446940.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20967.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 255 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQD 118 KKI FVEN+KLKSTLLE+IDE+QLPEIYGG++QLVPIQ+ Sbjct: 216 KKIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQN 254 >ref|XP_004501761.1| PREDICTED: random slug protein 5-like [Cicer arietinum] Length = 268 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +2 Query: 2 KKITFVENDKLKSTLLEEIDETQLPEIYGGQMQLVPIQDS 121 +KI FV+N KLKSTLLEEIDE+Q+PEIYGGQ+QLVP+Q+S Sbjct: 229 RKIVFVDNKKLKSTLLEEIDESQIPEIYGGQLQLVPVQNS 268