BLASTX nr result
ID: Astragalus23_contig00033853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00033853 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONI15884.1| hypothetical protein PRUPE_3G067000 [Prunus persica] 64 1e-09 gb|PNT54415.1| hypothetical protein POPTR_001G140200v3 [Populus ... 63 2e-09 gb|PNT54416.1| hypothetical protein POPTR_001G140200v3 [Populus ... 63 3e-09 gb|PNT54418.1| hypothetical protein POPTR_001G140200v3 [Populus ... 63 3e-09 gb|PNT54414.1| hypothetical protein POPTR_001G140200v3 [Populus ... 63 4e-09 ref|XP_017188538.1| PREDICTED: uncharacterized membrane protein ... 63 5e-09 gb|AFK33460.1| unknown [Medicago truncatula] 63 6e-09 ref|XP_011018536.1| PREDICTED: uncharacterized membrane protein ... 63 6e-09 ref|XP_006368381.1| hypothetical protein POPTR_0001s02260g [Popu... 63 6e-09 ref|XP_023553626.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_022967320.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_022963764.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_022159859.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_008465994.1| PREDICTED: uncharacterized membrane protein ... 63 6e-09 ref|XP_004136194.1| PREDICTED: uncharacterized membrane protein ... 63 6e-09 ref|XP_020206208.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_014519210.1| uncharacterized membrane protein At4g09580 [... 63 6e-09 ref|XP_007158286.1| hypothetical protein PHAVU_002G139800g [Phas... 63 6e-09 gb|AHA84287.1| SNARE associated Golgi protein [Phaseolus vulgaris] 63 6e-09 ref|XP_019445286.1| PREDICTED: uncharacterized membrane protein ... 63 6e-09 >gb|ONI15884.1| hypothetical protein PRUPE_3G067000 [Prunus persica] Length = 200 Score = 64.3 bits (155), Expect = 1e-09 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARVAPNAFLQKSATH 31 YTAQ L YY+VYI M TFMIPG FM LLVG+LFGVF+G+A V NA S+ + Sbjct: 51 YTAQVLLGYYMVYIFMTTFMIPGTVFMSLLVGSLFGVFRGIAFVVFNATTSASSCY 106 >gb|PNT54415.1| hypothetical protein POPTR_001G140200v3 [Populus trichocarpa] Length = 178 Score = 63.2 bits (152), Expect = 2e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 71 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 114 >gb|PNT54416.1| hypothetical protein POPTR_001G140200v3 [Populus trichocarpa] Length = 192 Score = 63.2 bits (152), Expect = 3e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 71 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 114 >gb|PNT54418.1| hypothetical protein POPTR_001G140200v3 [Populus trichocarpa] Length = 195 Score = 63.2 bits (152), Expect = 3e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 17 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 60 >gb|PNT54414.1| hypothetical protein POPTR_001G140200v3 [Populus trichocarpa] Length = 214 Score = 63.2 bits (152), Expect = 4e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 71 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 114 >ref|XP_017188538.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Malus domestica] Length = 210 Score = 62.8 bits (151), Expect = 5e-09 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARVAPNA 55 YTAQ L Y +VYI MQTFMIPG FM LL G+LFGVFKGVA V NA Sbjct: 32 YTAQVLLGYCMVYIFMQTFMIPGTVFMSLLAGSLFGVFKGVALVVFNA 79 >gb|AFK33460.1| unknown [Medicago truncatula] Length = 244 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 66 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 109 >ref|XP_011018536.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Populus euphratica] Length = 249 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 71 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 114 >ref|XP_006368381.1| hypothetical protein POPTR_0001s02260g [Populus trichocarpa] gb|PNT54417.1| hypothetical protein POPTR_001G140200v3 [Populus trichocarpa] Length = 249 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 71 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 114 >ref|XP_023553626.1| uncharacterized membrane protein At4g09580 [Cucurbita pepo subsp. pepo] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_022967320.1| uncharacterized membrane protein At4g09580 [Cucurbita maxima] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_022963764.1| uncharacterized membrane protein At4g09580 [Cucurbita moschata] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_022159859.1| uncharacterized membrane protein At4g09580 [Momordica charantia] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_008465994.1| PREDICTED: uncharacterized membrane protein At4g09580 [Cucumis melo] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_004136194.1| PREDICTED: uncharacterized membrane protein At4g09580 [Cucumis sativus] gb|KGN60367.1| hypothetical protein Csa_3G901130 [Cucumis sativus] Length = 253 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 75 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 118 >ref|XP_020206208.1| uncharacterized membrane protein At4g09580 [Cajanus cajan] gb|KYP35576.1| putative membrane protein At4g09580 family [Cajanus cajan] Length = 255 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 77 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 120 >ref|XP_014519210.1| uncharacterized membrane protein At4g09580 [Vigna radiata var. radiata] Length = 255 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 77 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 120 >ref|XP_007158286.1| hypothetical protein PHAVU_002G139800g [Phaseolus vulgaris] gb|ESW30280.1| hypothetical protein PHAVU_002G139800g [Phaseolus vulgaris] Length = 255 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 77 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 120 >gb|AHA84287.1| SNARE associated Golgi protein [Phaseolus vulgaris] Length = 255 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 77 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 120 >ref|XP_019445286.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Lupinus angustifolius] gb|OIW10675.1| hypothetical protein TanjilG_16047 [Lupinus angustifolius] Length = 257 Score = 63.2 bits (152), Expect = 6e-09 Identities = 34/44 (77%), Positives = 34/44 (77%) Frame = -3 Query: 198 YTAQHLGEYYVVYISMQTFMIPGDGFMLLLVGALFGVFKGVARV 67 YTAQ L Y VVYI MQTFMIPG FM LL GALFGVFKGVA V Sbjct: 79 YTAQVLVGYCVVYIFMQTFMIPGTVFMSLLAGALFGVFKGVALV 122