BLASTX nr result
ID: Astragalus23_contig00033755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00033755 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP58028.1| Retrovirus-related Pol polyprotein from transposo... 60 7e-08 ref|XP_012568372.1| PREDICTED: uncharacterized protein LOC105851... 58 3e-07 >gb|KYP58028.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 624 Score = 59.7 bits (143), Expect = 7e-08 Identities = 32/58 (55%), Positives = 35/58 (60%) Frame = -1 Query: 248 GNSPDSPLEPITLFPHALPQQLDLSIALQKHMYSTCNPSPHYATLRSHCLPPSHYTCI 75 G SPDS P P A P + DL IAL+K ST NPSPHY TL H L PS YTC+ Sbjct: 81 GPSPDSTSVPPPPSPPAQPLESDLPIALRKGNRSTRNPSPHYITLSYHRLSPSQYTCL 138 >ref|XP_012568372.1| PREDICTED: uncharacterized protein LOC105851619 [Cicer arietinum] Length = 323 Score = 57.8 bits (138), Expect = 3e-07 Identities = 38/94 (40%), Positives = 49/94 (52%) Frame = -1 Query: 356 PYLSITYPHPSVFTIQRCHIFKKIHIFTMLSPSTIDGNSPDSPLEPITLFPHALPQQLDL 177 P S + P + T QRC + + +L P T DSP P ALP + DL Sbjct: 167 PVESASQPPRPLQTYQRCRLPS---VVLVLVPIT------DSPPTPPP--DSALPPEHDL 215 Query: 176 SIALQKHMYSTCNPSPHYATLRSHCLPPSHYTCI 75 IAL+K++ +TCNPSP Y L H L P HYTC+ Sbjct: 216 PIALRKNIRTTCNPSPRYIDLCYHRLSPLHYTCL 249