BLASTX nr result
ID: Astragalus23_contig00033612
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00033612 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515902.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-13 ref|XP_016190144.1| pentatricopeptide repeat-containing protein ... 62 1e-08 ref|XP_015970183.1| pentatricopeptide repeat-containing protein ... 60 3e-08 ref|XP_021675833.1| pentatricopeptide repeat-containing protein ... 56 1e-06 ref|XP_018840083.1| PREDICTED: pentatricopeptide repeat-containi... 56 1e-06 ref|XP_018809541.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-06 ref|XP_021616821.1| pentatricopeptide repeat-containing protein ... 55 3e-06 gb|PON96743.1| Tetratricopeptide-like helical domain containing ... 55 3e-06 gb|PNY09851.1| pentatricopeptide repeat-containing protein chlor... 55 3e-06 gb|POE50776.1| pentatricopeptide repeat-containing protein, chlo... 55 3e-06 gb|POE52976.1| pentatricopeptide repeat-containing protein, chlo... 55 4e-06 ref|XP_023900423.1| pentatricopeptide repeat-containing protein ... 55 4e-06 ref|XP_023898625.1| pentatricopeptide repeat-containing protein ... 55 4e-06 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 ref|XP_010102683.1| pentatricopeptide repeat-containing protein ... 54 7e-06 ref|XP_008464511.1| PREDICTED: pentatricopeptide repeat-containi... 54 9e-06 ref|XP_013457737.1| PPR containing plant protein [Medicago trunc... 54 9e-06 gb|PON72293.1| Tetratricopeptide-like helical domain containing ... 54 9e-06 ref|XP_004515865.1| PREDICTED: pentatricopeptide repeat-containi... 54 9e-06 >ref|XP_004515902.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 635 Score = 73.6 bits (179), Expect = 9e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+FESF EG++SEAK LLSKCPSRIR R+++ EFF SVEN AAS Sbjct: 582 SAYLHVFESFIREGKLSEAKDLLSKCPSRIRRRRQVVEFFDSVENRNAAS 631 >ref|XP_016190144.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] Length = 643 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAA 149 SAY+H+FESF EGR S+A+ LLSKC I RK IR F SV NC AA Sbjct: 590 SAYVHVFESFFREGRESDARDLLSKCRRHITKRKEIRALFGSVRNCKAA 638 >ref|XP_015970183.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] Length = 643 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAA 149 SAY+H+FESF EGR S+A+ LLSKC I +K IR F SV NC AA Sbjct: 590 SAYVHVFESFFREGRESDARDLLSKCRRHITKQKEIRALFGSVRNCKAA 638 >ref|XP_021675833.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Hevea brasiliensis] Length = 629 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVEN 137 SAYLH+F+SF +EGR SEAK LL KCP RIR +I E F S ++ Sbjct: 580 SAYLHVFQSFFKEGRHSEAKDLLYKCPHRIRKHPKICELFGSAKS 624 >ref|XP_018840083.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Juglans regia] Length = 626 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F+SF +EGR SEAK LL KCP IR I + F S N AAS Sbjct: 577 SAYLHVFKSFFKEGRHSEAKDLLFKCPHHIRKHSEIGKLFGSTGNDNAAS 626 >ref|XP_018809541.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like, partial [Juglans regia] Length = 381 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F+SF +EGR SEAK LL KCP IR I E F S N A S Sbjct: 332 SAYLHVFKSFFQEGRHSEAKDLLFKCPHHIRMHGEITELFGSTGNGNATS 381 >ref|XP_021616821.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Manihot esculenta] gb|OAY47851.1| hypothetical protein MANES_06G110600 [Manihot esculenta] Length = 621 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVEN 137 SAYLH+F+SF +EGR SEAK LL KCP IR +I E F S ++ Sbjct: 576 SAYLHVFQSFFKEGRHSEAKDLLYKCPHHIRKHPKISELFGSAKS 620 >gb|PON96743.1| Tetratricopeptide-like helical domain containing protein [Trema orientalis] Length = 629 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F+SF EGR SEAK LL KCP IR + + F S E+ A S Sbjct: 580 SAYLHVFKSFFREGRYSEAKDLLFKCPHHIRKHHEVCKLFGSAESSPATS 629 >gb|PNY09851.1| pentatricopeptide repeat-containing protein chloroplastic-like [Trifolium pratense] Length = 455 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+FESF E R+SE K LL K P +IR RK++ EF + E+ AAS Sbjct: 403 SAYLHVFESFKAEDRLSEVKDLLCKYPFQIRRRKKVSEFTSLCEDSDAAS 452 >gb|POE50776.1| pentatricopeptide repeat-containing protein, chloroplastic [Quercus suber] Length = 497 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F SF +EGR SEAK LL KCP IR I F S +N A S Sbjct: 448 SAYLHVFRSFFQEGRESEAKDLLFKCPHHIRKHGEICNLFGSAQNDNATS 497 >gb|POE52976.1| pentatricopeptide repeat-containing protein, chloroplastic [Quercus suber] Length = 603 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F SF +EGR SEAK LL KCP IR I F S +N A S Sbjct: 554 SAYLHVFRSFFQEGRESEAKDLLFKCPHHIRKHGEICNLFGSAQNDNATS 603 >ref|XP_023900423.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Quercus suber] Length = 630 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F SF +EGR SEAK LL KCP IR I F S +N A S Sbjct: 581 SAYLHVFRSFFQEGRESEAKDLLFKCPHHIRKHGEICNLFGSAQNDNATS 630 >ref|XP_023898625.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Quercus suber] Length = 630 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/50 (56%), Positives = 31/50 (62%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F SF +EGR SEAK LL KCP IR I F S +N A S Sbjct: 581 SAYLHVFRSFFQEGRESEAKDLLFKCPHHIRKHGEICNLFGSAQNDNATS 630 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Cucumis sativus] gb|KGN63535.1| hypothetical protein Csa_1G003530 [Cucumis sativus] Length = 632 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/54 (55%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVE-NCMAASRVS 161 SAYLHIF SF EGR SEAK LL KCP IR + + F S E N AA++ S Sbjct: 573 SAYLHIFNSFFNEGRYSEAKDLLFKCPHHIRKHNEVCKLFGSAESNTTAATQSS 626 >ref|XP_010102683.1| pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Morus notabilis] gb|EXB93901.1| hypothetical protein L484_002057 [Morus notabilis] Length = 628 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAY HIFESF EGR SEAK LL KCP IR + I + F S ++ A + Sbjct: 579 SAYFHIFESFFREGRHSEAKDLLFKCPHHIRKHRDIAKLFGSTQSSPATA 628 >ref|XP_008464511.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Cucumis melo] Length = 623 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVEN 137 SAYLHIF SF EGR SEAK LL KCP IR + + F S E+ Sbjct: 573 SAYLHIFNSFFNEGRYSEAKDLLFKCPHHIRKHNEVCKLFGSAES 617 >ref|XP_013457737.1| PPR containing plant protein [Medicago truncatula] gb|KEH31768.1| PPR containing plant protein [Medicago truncatula] Length = 628 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFA 125 SAYLH+ ESF EGR+SE K LL K PS+I+ K+I EFF+ Sbjct: 577 SAYLHVLESFIGEGRLSEVKDLLCKFPSQIKRHKKINEFFS 617 >gb|PON72293.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 629 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/50 (54%), Positives = 31/50 (62%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAAS 152 SAYLH+F+SF EGR SEA LL KCP IR I + F S E+ A S Sbjct: 580 SAYLHVFKSFFREGRYSEANDLLFKCPHHIRKHHEICKLFGSAESSPATS 629 >ref|XP_004515865.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Cicer arietinum] Length = 641 Score = 53.5 bits (127), Expect = 9e-06 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = +3 Query: 3 SAYLHIFESFTEEGRVSEAKYLLSKCPSRIRNRKRIREFFASVENCMAASRV 158 + YL IF+S EEGR+SEAK LL KCP IR +I E F S E+ A S+V Sbjct: 582 TVYLKIFKSLFEEGRLSEAKDLLYKCPPHIRKHSQISELFGSSESQKAESQV 633