BLASTX nr result
ID: Astragalus23_contig00032731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032731 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492803.1| PREDICTED: sphingoid long-chain bases kinase... 68 8e-11 gb|AFK44010.1| unknown [Medicago truncatula] 60 6e-09 gb|PNY06110.1| diacylglycerol kinase-like protein [Trifolium pra... 62 1e-08 ref|XP_003624079.2| YegS/Rv2252/BmrU family lipid kinase [Medica... 61 2e-08 dbj|GAU32008.1| hypothetical protein TSUD_157970 [Trifolium subt... 60 4e-08 >ref|XP_004492803.1| PREDICTED: sphingoid long-chain bases kinase 2, mitochondrial-like [Cicer arietinum] Length = 354 Score = 67.8 bits (164), Expect = 8e-11 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = +2 Query: 203 SMVNTTMVFKSELQPMTPERSIGNDXXXXXXXXXXXDLVFIVNPQGANGRTG 358 SMVNTTMVF+SELQP TPER +G D DLVFIVNPQGANGRTG Sbjct: 9 SMVNTTMVFRSELQPFTPERFLGID--SSSSSSRRRDLVFIVNPQGANGRTG 58 >gb|AFK44010.1| unknown [Medicago truncatula] Length = 162 Score = 60.5 bits (145), Expect = 6e-09 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +2 Query: 215 TTMVFKSELQPMTPERSIGNDXXXXXXXXXXXDLVFIVNPQGANGRTG 358 TTMVF+SELQP+TPER +G D DL+FIVNPQGANGRTG Sbjct: 12 TTMVFRSELQPITPERFLGID---SSSSSRRRDLIFIVNPQGANGRTG 56 >gb|PNY06110.1| diacylglycerol kinase-like protein [Trifolium pratense] Length = 389 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/53 (66%), Positives = 39/53 (73%) Frame = +2 Query: 200 MSMVNTTMVFKSELQPMTPERSIGNDXXXXXXXXXXXDLVFIVNPQGANGRTG 358 +SMV+T MVF+SELQPMTPER +G D DLVFIVNPQGANGRTG Sbjct: 8 ISMVHT-MVFRSELQPMTPERFLGIDSSSSSRRK---DLVFIVNPQGANGRTG 56 >ref|XP_003624079.2| YegS/Rv2252/BmrU family lipid kinase [Medicago truncatula] gb|AES80297.2| YegS/Rv2252/BmrU family lipid kinase [Medicago truncatula] Length = 343 Score = 60.8 bits (146), Expect = 2e-08 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = +2 Query: 215 TTMVFKSELQPMTPERSIGNDXXXXXXXXXXXDLVFIVNPQGANGRTG 358 TTMVF+SELQP+TPER +G D DLVFIVNPQGANGRTG Sbjct: 3 TTMVFRSELQPITPERFLGID---SSSSSRRRDLVFIVNPQGANGRTG 47 >dbj|GAU32008.1| hypothetical protein TSUD_157970 [Trifolium subterraneum] Length = 352 Score = 60.1 bits (144), Expect = 4e-08 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = +2 Query: 203 SMVNTTMVFKSELQPMTPERSIGNDXXXXXXXXXXXDLVFIVNPQGANGRTG 358 SMVNT MVF+SE QP+TPER +G D DLVFIVNPQGANGRTG Sbjct: 9 SMVNT-MVFRSEFQPITPERFLGIDSSSSSRRK---DLVFIVNPQGANGRTG 56