BLASTX nr result
ID: Astragalus23_contig00032710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032710 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013467521.1| hypothetical protein MTR_1g052285 [Medicago ... 57 1e-06 >ref|XP_013467521.1| hypothetical protein MTR_1g052285 [Medicago truncatula] gb|KEH41558.1| hypothetical protein MTR_1g052285 [Medicago truncatula] Length = 637 Score = 57.4 bits (137), Expect = 1e-06 Identities = 36/98 (36%), Positives = 46/98 (46%) Frame = -2 Query: 472 CSAVFDKEAAKVVEGYMDQEQRKRKWLDNRPSFDFGNTELPGYKANATAKPSSSKANVST 293 CSAVFDKEAAK +EG+ Q + K W DNRP F F +P YK T S + Sbjct: 532 CSAVFDKEAAKSIEGFQPQTKHKGGWTDNRPKFVFNKRGVP-YKMKLTENLQSG----NW 586 Query: 292 KPSTSQKPGKKGSIRLFGKSFVPQTNSPVGKWVHNNAP 179 K + S +F + ++P KWV AP Sbjct: 587 KKTFSPPARSPTDAWVFSEGKKSGYSAPPTKWVKKMAP 624