BLASTX nr result
ID: Astragalus23_contig00032227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032227 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX55120.1| hypothetical protein L195_g048746, partial [Trifo... 64 2e-10 >gb|PNX55120.1| hypothetical protein L195_g048746, partial [Trifolium pratense] Length = 63 Score = 63.9 bits (154), Expect = 2e-10 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 269 MVSM*VLSL-DGGFWRPAKKLPCKYGVAAYGRNMADLIGIATYGGWHRIRHAIIPWRH 439 ++++ VLS+ DGG W+ A P K+ +AAY RNMA +IG A Y H+I HAI PWRH Sbjct: 6 LLTLPVLSMTDGGLWQSATNPPYKHAIAAYDRNMAGIIGAAAYCSRHKICHAITPWRH 63