BLASTX nr result
ID: Astragalus23_contig00032052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00032052 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] 56 2e-07 >gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] Length = 59 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 109 MKVEGIRPLPLPLPDQSAPSFITLIINRAYSGPSHKGRGH 228 +KVEG+RPL ++ PSFI+LIINRAYSGPSH+GRGH Sbjct: 26 IKVEGMRPL------KADPSFISLIINRAYSGPSHRGRGH 59