BLASTX nr result
ID: Astragalus23_contig00031418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031418 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004514717.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 108 5e-27 ref|XP_012575490.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 108 5e-27 ref|XP_009385872.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 98 9e-23 ref|XP_021626638.1| thioredoxin-like 3-2, chloroplastic isoform ... 96 4e-22 ref|XP_021626637.1| thioredoxin-like 3-2, chloroplastic isoform ... 96 8e-22 ref|XP_021626636.1| thioredoxin-like 3-2, chloroplastic isoform ... 96 9e-22 ref|XP_012080950.1| thioredoxin-like 3-2, chloroplastic [Jatroph... 96 1e-21 ref|XP_022765415.1| thioredoxin-like 3-2, chloroplastic isoform ... 94 2e-21 ref|XP_022765414.1| thioredoxin-like 3-2, chloroplastic isoform ... 94 2e-21 ref|XP_021672624.1| thioredoxin-like 3-2, chloroplastic isoform ... 94 3e-21 ref|XP_017603906.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 94 3e-21 ref|XP_021672623.1| thioredoxin-like 3-2, chloroplastic isoform ... 94 3e-21 ref|XP_017603905.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 94 3e-21 ref|XP_013467335.1| thioredoxin [Medicago truncatula] >gi|657402... 92 5e-21 ref|XP_021672622.1| thioredoxin-like 3-2, chloroplastic isoform ... 94 5e-21 ref|XP_013467334.1| thioredoxin [Medicago truncatula] >gi|657402... 92 5e-21 ref|XP_021296189.1| thioredoxin-like 3-2, chloroplastic isoform ... 92 9e-21 ref|XP_018828851.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 92 9e-21 ref|XP_007009915.2| PREDICTED: thioredoxin-like 3-2, chloroplast... 92 1e-20 ref|XP_015581933.1| PREDICTED: thioredoxin-like 3-2, chloroplast... 92 1e-20 >ref|XP_004514717.1| PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X2 [Cicer arietinum] Length = 188 Score = 108 bits (270), Expect = 5e-27 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = +2 Query: 230 EDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 +D VS +HLQ ICSEDHFDRVVAEA ++ LLVVWMASWCRKCIYLKPKLEKLAVDYYP Sbjct: 64 DDSVSSLHLQPICSEDHFDRVVAEAQRQQHALLVVWMASWCRKCIYLKPKLEKLAVDYYP 123 >ref|XP_012575490.1| PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X1 [Cicer arietinum] Length = 189 Score = 108 bits (270), Expect = 5e-27 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = +2 Query: 230 EDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 +D VS +HLQ ICSEDHFDRVVAEA ++ LLVVWMASWCRKCIYLKPKLEKLAVDYYP Sbjct: 64 DDSVSSLHLQPICSEDHFDRVVAEAQRQQHALLVVWMASWCRKCIYLKPKLEKLAVDYYP 123 >ref|XP_009385872.1| PREDICTED: thioredoxin-like 3-2, chloroplastic [Musa acuminata subsp. malaccensis] Length = 197 Score = 97.8 bits (242), Expect = 9e-23 Identities = 40/62 (64%), Positives = 53/62 (85%) Frame = +2 Query: 224 QEEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDY 403 +EE+P + + L+ I SE+HFDR++AEAHQ + ++V+WMASWCRKCIYLKPKLEKLA +Y Sbjct: 75 EEEEPPTSVALEPIVSEEHFDRIIAEAHQLEEPIVVLWMASWCRKCIYLKPKLEKLAAEY 134 Query: 404 YP 409 YP Sbjct: 135 YP 136 >ref|XP_021626638.1| thioredoxin-like 3-2, chloroplastic isoform X3 [Manihot esculenta] gb|OAY38873.1| hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 169 Score = 95.5 bits (236), Expect = 4e-22 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKPKLEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_021626637.1| thioredoxin-like 3-2, chloroplastic isoform X2 [Manihot esculenta] gb|OAY38875.1| hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 200 Score = 95.5 bits (236), Expect = 8e-22 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKPKLEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_021626636.1| thioredoxin-like 3-2, chloroplastic isoform X1 [Manihot esculenta] gb|OAY38874.1| hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 206 Score = 95.5 bits (236), Expect = 9e-22 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKPKLEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_012080950.1| thioredoxin-like 3-2, chloroplastic [Jatropha curcas] Length = 212 Score = 95.5 bits (236), Expect = 1e-21 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS I L++ICSE FDRV+AEA Q + +++VWMASWCRKCIYLKPKLEKLA DYY Sbjct: 90 DDSPVS-IELETICSESQFDRVIAEAQQLEEAVIIVWMASWCRKCIYLKPKLEKLAADYY 148 Query: 407 P 409 P Sbjct: 149 P 149 >ref|XP_022765415.1| thioredoxin-like 3-2, chloroplastic isoform X2 [Durio zibethinus] Length = 187 Score = 94.4 bits (233), Expect = 2e-21 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PV+ + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA DYY Sbjct: 81 DDAPVA-VELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYY 139 Query: 407 P 409 P Sbjct: 140 P 140 >ref|XP_022765414.1| thioredoxin-like 3-2, chloroplastic isoform X1 [Durio zibethinus] Length = 203 Score = 94.4 bits (233), Expect = 2e-21 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PV+ + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA DYY Sbjct: 81 DDAPVA-VELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYY 139 Query: 407 P 409 P Sbjct: 140 P 140 >ref|XP_021672624.1| thioredoxin-like 3-2, chloroplastic isoform X3 [Hevea brasiliensis] Length = 178 Score = 93.6 bits (231), Expect = 3e-21 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKP+LEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESVIVVWMASWCRKCIYLKPQLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_017603906.1| PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X2 [Gossypium arboreum] gb|KHG26993.1| Thioredoxin-like 3-2, chloroplastic [Gossypium arboreum] Length = 197 Score = 94.0 bits (232), Expect = 3e-21 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +2 Query: 230 EDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 +D + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA DYYP Sbjct: 81 DDAPLTVELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYYP 140 >ref|XP_021672623.1| thioredoxin-like 3-2, chloroplastic isoform X2 [Hevea brasiliensis] Length = 183 Score = 93.6 bits (231), Expect = 3e-21 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKP+LEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESVIVVWMASWCRKCIYLKPQLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_017603905.1| PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X1 [Gossypium arboreum] Length = 203 Score = 94.0 bits (232), Expect = 3e-21 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +2 Query: 230 EDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 +D + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA DYYP Sbjct: 81 DDAPLTVELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYYP 140 >ref|XP_013467335.1| thioredoxin [Medicago truncatula] gb|KEH41372.1| thioredoxin [Medicago truncatula] Length = 148 Score = 92.0 bits (227), Expect = 5e-21 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 224 QEEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDY 403 Q++D V LQ ICSEDHF+RV+A++ LLVVWMA+WCRKCIYLKPKLEKLAVDY Sbjct: 69 QDDDSVVVSSLQPICSEDHFNRVLAQSQH---ALLVVWMANWCRKCIYLKPKLEKLAVDY 125 Query: 404 YP 409 YP Sbjct: 126 YP 127 >ref|XP_021672622.1| thioredoxin-like 3-2, chloroplastic isoform X1 [Hevea brasiliensis] Length = 206 Score = 93.6 bits (231), Expect = 5e-21 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L+ ICSE FDRV+AEA Q ++++VVWMASWCRKCIYLKP+LEKLA DYY Sbjct: 84 DDSPVS-VELEPICSESQFDRVIAEAQQLEESVIVVWMASWCRKCIYLKPQLEKLAADYY 142 Query: 407 P 409 P Sbjct: 143 P 143 >ref|XP_013467334.1| thioredoxin [Medicago truncatula] gb|KEH41371.1| thioredoxin [Medicago truncatula] Length = 152 Score = 92.0 bits (227), Expect = 5e-21 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 224 QEEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDY 403 Q++D V LQ ICSEDHF+RV+A++ LLVVWMA+WCRKCIYLKPKLEKLAVDY Sbjct: 69 QDDDSVVVSSLQPICSEDHFNRVLAQSQH---ALLVVWMANWCRKCIYLKPKLEKLAVDY 125 Query: 404 YP 409 YP Sbjct: 126 YP 127 >ref|XP_021296189.1| thioredoxin-like 3-2, chloroplastic isoform X2 [Herrania umbratica] Length = 170 Score = 92.0 bits (227), Expect = 9e-21 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +2 Query: 248 IHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA +YYP Sbjct: 87 VELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAAEYYP 140 >ref|XP_018828851.1| PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X3 [Juglans regia] Length = 160 Score = 91.7 bits (226), Expect = 9e-21 Identities = 40/61 (65%), Positives = 50/61 (81%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS + L ICSE FDRV+AEA Q +++++VWMASWCRKCIYLKPKLEKLA D+Y Sbjct: 76 DDSPVS-VELHPICSETQFDRVLAEAQQLEESIIIVWMASWCRKCIYLKPKLEKLAADFY 134 Query: 407 P 409 P Sbjct: 135 P 135 >ref|XP_007009915.2| PREDICTED: thioredoxin-like 3-2, chloroplastic [Theobroma cacao] Length = 203 Score = 92.4 bits (228), Expect = 1e-20 Identities = 39/60 (65%), Positives = 48/60 (80%) Frame = +2 Query: 230 EDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYYP 409 +D + LQ ICSE FDRV+AEA Q ++L+++WMASWCRKCIYLKPKLEKLA +YYP Sbjct: 81 DDAPLAVELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAAEYYP 140 >ref|XP_015581933.1| PREDICTED: thioredoxin-like 3-2, chloroplastic [Ricinus communis] Length = 203 Score = 92.4 bits (228), Expect = 1e-20 Identities = 41/61 (67%), Positives = 49/61 (80%) Frame = +2 Query: 227 EEDPVSFIHLQSICSEDHFDRVVAEAHQRNDTLLVVWMASWCRKCIYLKPKLEKLAVDYY 406 ++ PVS I L ICSE FDRV+AEA Q + ++++WMASWCRKCIYLKPKLEKLA DYY Sbjct: 81 DDSPVS-IELVPICSESQFDRVIAEAQQLEEPVIIIWMASWCRKCIYLKPKLEKLAADYY 139 Query: 407 P 409 P Sbjct: 140 P 140